KEGG   Cyprinodon variegatus (sheepshead minnow): 107097030Help
Entry
107097030         CDS       T06110                                 

Gene name
wdr48
Definition
(RefSeq) WD repeat-containing protein 48 isoform X1
  KO
K15361  WD repeat-containing protein 48
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107097030 (wdr48)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107097030 (wdr48)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107097030 (wdr48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3337 WD40 ANAPC4_WD40 RAWUL WD40_like
Motif
Other DBs
NCBI-GeneID: 107097030
NCBI-ProteinID: XP_015249481
Ensembl: ENSCVAG00000015450
UniProt: A0A3Q2E8A4
LinkDB All DBs
Position
Unknown
AA seq 677 aa AA seqDB search
MATHHRQNAAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVY
QHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYV
KALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMG
TVIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKSLLLNRDGTQCLSGSSDGTIRLWSLG
QQRCIATYRVHDEGVWALQVNEAFTHVYSGGRDKKIYCTDLRNPDIRVLICEEKAPVLKM
ELDRSADPPPAIWVSTTKSSVNKWSLKGMHNFRSSGEYDNDCTTPLTPLCTQPEQVIKGG
ASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKGEDLGKVEFDEEIKKRFKMVYVPNWF
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSSDGSDPKLNLGGLLLQALLEFWPRTRIN
PMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESM
LLNETVPQWVIDITVDKNMPKFNKIPFYLQPHSSSGAKTLKKDRLSASDMLQVRKVMEHV
YEKIINLDNESQTTSSTANDKPGEQEKEEDMAMLAEEKIELMCQDQVLDPNMDLRTVKHF
IWKSGGDLTLHYRQKST
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcatcataggcaaaatgctgctgggcggagaaaagtacaggtttcatacgtg
attagagatgaggtagagaaatacaatcgcaatggggtaaacgcactccagttagaccct
gctttgaatcggctctttaccgcaggcagagactccatcatccggatatggagtgtctac
caacacaaacaggacccatatatagcatctatggagcatcacacagactgggttaatgat
atagttctctgctgcaatggaaaaacattgatatcagcctcatcggatacaacagtgaaa
gtatggaacgctcataaaggattttgtatgtcgacgttacggacccacaaggactatgta
aaagctttagcctatgctaaggacaaggagctcgtagcgtcggctggtcttgaccggcag
atcttcctatgggatgttaacacactaacggcactcaccgcttccaacaacactgtcacc
acttcgtccctgagcgggaacaaggactccatctatagcctggctatgaaccagatggga
acagttattgtttctggatctactgaaaaggttttgagagtgtgggatcctcgaacatgt
gcaaagcttatgaagctaaagggtcacacagacaacgtcaagtctttgctcctgaatcgc
gatggcactcagtgcctatcgggtagctcagacgggaccatccgcctgtggtcgctcggc
cagcagaggtgcatcgccacgtacagggtgcatgatgaaggcgtctgggccctgcaggtc
aacgaggcctttacacatgtatattccggaggcagagacaagaaaatctactgcactgac
ctgcgaaacccagacatccgcgtgctgatctgtgaggagaaggctccggtgctgaagatg
gaactagacagatctgctgacccacctccagcgatctgggtttccaccaccaagtcatct
gtgaataaatggtcactaaagggaatgcacaactttagatcatcaggggagtatgataat
gactgcaccacccctctgactccactgtgtactcagccagaacaagttattaagggaggt
gccagtattatacagtgccacattctgaatgacaagagacacatactcactaaagacacc
aacaacaatgtggcatattgggatgtgctcaaggcttgtaaaggtgaagacttggggaaa
gtggaatttgatgaagaaatcaaaaagcggttcaagatggtctacgtgccaaactggttc
tccgttgacctgaaaactgggatgctcacaattaccctggatgagagtgattgctttgct
gcctgggtgtctgcaaaggatgctgggttttcaagttctgatggatctgatccaaagttg
aacctgggcggcttgttgctccaagctctgctggagttctggcccagaacccggataaac
cccatggatgaggaggaaaacgaggtgaaccacgtgaacggagagcaggagaacagggtg
cagaaaggaaacggatatttccaggttccaccacacacgcctgttatcttcggagaagcg
ggaggaagaactctatttaggctgctatgtagagattcaggtggagagaccgagtccatg
ctgctcaatgagacggtcccacagtgggtcattgatataactgtagataaaaatatgccc
aagttcaacaaaatcccattctacctccaaccacattcttcttctggtgcaaaaactcta
aaaaaggaccgtctctcagctagtgatatgctccaggtgaggaaggtgatggagcatgtt
tacgagaagattataaacttggacaatgagtcgcagaccaccagctccacggccaacgat
aagcctggggagcaggagaaggaggaggacatggccatgcttgctgaggagaagattgag
ttgatgtgtcaggaccaggttctcgaccccaacatggacctgcggacagttaaacatttt
atctggaagagtggcggggacttgacacttcactatagacagaagtctacatga

DBGET integrated database retrieval system