KEGG   Cyprinodon variegatus (sheepshead minnow): 107097448Help
Entry
107097448         CDS       T06110                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G-like
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107097448
   04020 Calcium signaling pathway
    107097448
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cvg04040]
    107097448
Ion channels [BR:cvg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107097448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel DPM3
Motif
Other DBs
NCBI-GeneID: 107097448
NCBI-ProteinID: XP_015250080
LinkDB All DBs
Position
Unknown
AA seq 1477 aa AA seqDB search
MAEDGGNLSSLPKVRGSENRSSLPRNFIPLNDLSGMAAEGGEGISGSSELVIERASPAPD
GISVAGDDGSTQGGGKSQPYPEYAPVVFFYMKQTTPPRSWCIKMVRNPWFERVSMLVILL
NCVTLGMYHPCEDECELDRCKILQHFDDFIFAFFAIEMVIKMVALGIFGKKCYLGDTWNR
LDFFIVLAGMLEYSLNLQNVSFSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNV
LLLCFFVFFIFGIVGVQLWKGLLRNRCFIEENFSFPLSLNLGNYYQTENDDENPFICSME
GHNGMRECDSVPKLYEAGQQCTLNIDSYNSTDNTTCVNWNQYYTNCSAGDINPFKNAINF
DNIFYAWIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIIGSFFMINLCLVVIATQ
FSETKQRESQLMKEQRVRHMSNASTLASQSEPGSCYDELLKYLVHVIQKGARQVAGVCRV
LARHAGFKIPASQPSSEAQHNKRLRSRRKPSRQGSVLVHHHHHHHHHNHYHLGNGSIWEE
GSMRCMEGRDIEAGPPKATTNIIPLGVVAPSSVISTTSDSNLTVLGAADSSSGCCVLNTE
ASPCTLFSTNNPVASLAPTASSRAMKRNSVPFAAPGPKNYPTLQTRIQAESRRGSVAASI
RSNLSCNLNIYPIHLDRQQSCNPSAQISRQLSAHELITMDAARLTMDPETCPDCAKALAN
ESEGFTEGNETQGDSDSDGVHEYEDLRHRNRRDSRQPRKKRRRLGKTAAKVVHFWRLACA
TFKKIVDSDYFGRGIMIAILINTLSMGIEYHQQPVELTNALEISNIVFTSLFALEMILNI
LVYGPFGYIKDPYNIFDGIIVVISVWEIVARQDGGLSVLRTFRLMRVLKLVRFMPALQRQ
LVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFCSEKDGVTIPDRKNFDSLLWAIV
TVFQILTQEDWNKVLYNGMAATSPVAALYFIALMTFGNYVLFNLLVAILVEGFQTEEITK
REDLHAQLSLIQLPIDSGGDILKNGSEIDSVTRSKEDFPGGKKDLQPSSVPLNGHVEMRT
SLTPPVITHTAPTPMPVPKLPVAGDPALVYESHHGSSISIDPASYDKSPTSARSSPLGQW
ASGSSWGSRRSSWTSLNRAPSYKRQKCQSGERRSLLSGEGDSSSDDGEGGGGVLEEDDKS
LPRTDSMSQSQRAPRHRRMESVETRSSMDLPPENSLQVPYLHRTSSMQSSRPPSLGHGRT
AEHNDCNGKGSPSALSQTNVSQDENTEDENVEEEVSQGRLARILRWMEKKQPEWCRQRDT
WSLYLFPPESRCRRQCEKIINHKMFDHVVLVIIFLNCITIAMERPGISPDSAERIFLMWS
DYIFTAIFVAEMTVKEPDEVARAFVPDASWSPPSGGVPAMSHWEEAWWKAKDTGGIMSLC
WPGVAFGFPESSWRTCVWIGKSVHLGLDCCLRDPATD
NT seq 4434 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggatgggggaaatctctcctcgctccctaaagtcaggggttcggaaaatcgc
tcctctcttccgaggaatttcatcccacttaacgacctgtccgggatggctgcagaaggt
ggggagggtattagcggaagcagcgagctggtgatagagcgagcatccccagcccctgat
gggatctctgtggccggggacgatggatccacgcagggtggagggaagagtcagccctac
cctgagtatgcacctgtggtcttcttctacatgaaacaaaccacacctccccgaagttgg
tgtatcaaaatggtccgcaacccatggttcgagcgagtgtccatgttggtgatcctgctg
aactgtgtgaccctgggcatgtatcatccctgcgaagatgaatgtgagttggatcggtgt
aaaattctacagcacttcgatgacttcatctttgccttcttcgctattgagatggtgatc
aagatggtagccctggggatttttggcaagaaatgttaccttggagacacgtggaaccgc
ttggacttcttcatagtattggctgggatgttggagtactcactaaacctgcaaaacgtt
agcttttcagcagtgagaacagttcgcgtgctgagaccgctgagagccatcaatcgggtg
ccaagcatgcgcatcctggtgaccctactgctggacacactgcccatgctgggtaatgtg
cttttactttgcttctttgtcttcttcatctttggtatcgttggtgtccagctgtggaaa
ggcctactcagaaaccgctgtttcattgaagaaaacttctccttccctctttccctgaac
cttggaaattattaccaaacagagaatgatgatgagaaccccttcatctgctctatggag
ggacacaacggcatgagggagtgcgactcagttcccaagctgtacgaggcaggccagcag
tgcacgctaaatattgactcctacaacagcacagataacaccacctgtgtgaactggaac
cagtactacaccaattgctctgctggcgacataaacccctttaaaaatgctatcaatttt
gacaacatcttctatgcgtggatagccatctttcaggtgatcactttggagggttgggtg
gacatcatgtactttgtcatggatgcccactctttctacaacttcatctactttatccta
cttattattatcggctcgtttttcatgatcaacctgtgcctagtggttatcgcaactcag
ttctcagaaaccaagcagagggagagccagctgatgaaagagcaacgtgtgcgtcacatg
tctaatgccagcactttggcttctcagtctgagccaggctcctgctatgatgagctactg
aagtacctggttcacgtcatccaaaagggggccaggcaagtggctggtgtttgtagggtc
ttggcccgccatgcaggatttaagattcccgcatcacaaccatcttcagaggcacagcat
aacaagaggctgagaagtagaagaaaaccatccagacaaggatcagtgttggttcaccat
catcatcatcatcaccaccacaatcactaccatctaggtaatggtagcatctgggaggaa
gggagcatgagatgtatggagggaagggacattgaagccgggcctcccaaagcaaccaca
aacattattccactgggtgtggtagcaccatcatctgtgatatccacaacctctgactca
aatctcactgtgttgggagctgctgattcatcctcaggctgctgtgtgctcaacacagag
gcctctccctgcactttgttttccaccaacaatccagtagcctccctagctccaaccgca
tcatccagagccatgaagaggaactctgtaccatttgctgctcctgggcctaagaactac
ccaaccctacagaccaggatccaggcagagtccaggcgagggagtgttgctgccagcatt
cgatcaaatctgagttgtaacctgaatatctatcccatacatctggacagacagcaatca
tgcaatccatcagctcagatctcccgccagctgtcagctcatgagctcatcaccatggac
gcagctcgtctgaccatggaccccgagacctgtcctgattgcgcaaaggcactggccaat
gagtctgagggctttacagagggcaacgagacacaaggcgactcagacagtgatggggta
cacgagtacgaggacctccgccacaggaacaggagagacagtcggcagcccagaaagaaa
aggcggaggttagggaagacagcagcaaaggtcgtccacttttggaggctggcgtgtgcc
acctttaagaagattgtggatagtgattactttggtcgagggattatgattgccattctt
ataaacactctgagcatggggatcgagtaccatcagcagccggtggagctgaccaatgcc
ctggagatcagcaacattgtcttcaccagcctgtttgccctggaaatgattctcaacatt
ttagtctatggaccttttggctacatcaaagatccctacaacatctttgatggcattatt
gtggtgatcagtgtttgggagattgtggcaaggcaggatggtggcctctctgtgctgaga
acgttccgactaatgcgggtcttgaagttggtccgtttcatgccagctctgcagaggcag
ctggtggtgctgatgaagacgatggacaacgtggccaccttctgtatgctgctcatgctc
ttcatcttcatcttcagtatactggggatgcatctgtttggctgtaagttttgctctgag
aaagatggagtcacaattccggacagaaaaaattttgactccctcctttgggccatagtg
acagtgtttcagatcctgacccaggaggactggaacaaggtgctatataatggcatggct
gccacctctcctgtagcagcactttacttcatcgcactcatgacttttggaaactatgtt
ctcttcaacttgcttgtggccatcctagttgaaggatttcagactgaggaaattaccaag
cgggaggacttgcatgcccagctgagcctaattcagctgcctatagactcagggggggat
attttgaaaaatggttcagagattgattctgttacacgaagtaaggaagatttccctggc
ggcaaaaaggatttacaaccctcctcagtcccactaaatggccatgtggaaatgaggaca
agtctgacaccaccagtcatcacccacactgctccgacgcccatgcctgttcccaaatta
cctgtagcaggcgaccctgccctggtctatgaatcccatcatggcagcagtatctccata
gacccagccagctatgataaatcacctaccagtgcccgctcctctccccttggtcagtgg
gcctctggcagcagctggggcagccgcaggtccagctggaccagcctaaaccgtgcccca
tcatacaagcggcagaagtgccagtccggggagcggcgatctctcctgtccggagagggc
gactctagctctgatgatggagaaggtgggggtggggtgctggaagaagatgacaagtcc
cttccaaggacagactcaatgtcacagtctcagagggcaccacgacacaggaggatggag
tctgttgaaactcgcagctccatggatttgcctcctgaaaactcactgcaggtgccctac
ctgcaccgcacatccagcatgcagagctccagacccccttccctgggccatggccgaact
gcagagcacaacgactgtaatgggaagggatctccatcagccctcagccagactaatgtc
tctcaagacgaaaacactgaagacgagaatgtggaggaggaggtcagccagggacgtttg
gccaggatacttcgatggatggagaaaaagcagccagaatggtgccggcagagagataca
tggtccctctacctgttccccccggagtccagatgccgcaggcaatgtgaaaagatcatc
aaccataaaatgtttgaccatgttgtgctggtcatcatttttctcaactgcatcaccatc
gccatggagaggcctggcatcagtcctgacagtgcggagcggatcttcctgatgtggtct
gactacatctttacagcgatatttgtggcagagatgaccgtaaaggagccagatgaggtg
gctcgggcatttgttccggatgcttcctggtcccctccctcaggaggtgttccagccatg
tcccattgggaggaggcctggtggaaggccaaggacactggagggattatgtctctgtgc
tggcctggtgtcgcttttggattccctgagagcagctggaggacgtgtgtgtggatcggg
aagtctgtgcatcttggcttagactgctgcctccgcgacccggccacggattaa

DBGET integrated database retrieval system