KEGG   Cyprinodon variegatus (sheepshead minnow): 107097852
Entry
107097852         CDS       T06110                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04012  ErbB signaling pathway
cvg04068  FoxO signaling pathway
cvg04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107097852 (cdkn1b)
   04068 FoxO signaling pathway
    107097852 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107097852 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107097852
NCBI-ProteinID: XP_015250658
Ensembl: ENSCVAG00000007978
UniProt: A0A3Q2DW73
LinkDB
Position
Unknown
AA seq 202 aa
MKTGRSWLLEDSAFLGGKMSDVRLSNGSPTLERTEPRLSEHPKPSACRNLFGSVDHEELN
RDLKGHMRELQDLAAAEWGFDFARDVPLPNSRFIWERVDSAEMPDFYVRPPRKEKGVCSG
NTKVDVNGNHSCVLVAPPSEETSLSVGQTECTEQCAGLRKRPCHDPSAQSKRSRSSPDEV
SCPSLSHSVEHTPRKSSPKRQT
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaaaccggacgctcctggctgctagaagattcagcttttttaggaggtaaaatgtca
gacgttcgactttcaaacggaagcccgacgttggagcggacggaaccccggctgtcggag
cacccgaagccgtcagcctgccggaacctcttcggctcggtggaccacgaagagttaaac
agggatttaaagggacacatgcgggagctgcaggaccttgcggcagcggagtggggcttc
gacttcgcccgtgacgtgccgctgccgaactccaggttcatttgggaacgagtggactcc
gcggagatgccggatttctacgtgcggccgccgcggaaggagaaaggcgtctgctctggg
aataccaaggtggatgttaacgggaatcatagctgtgttctggtggctcctccgagcgaa
gaaaccagcctgtctgtgggtcagaccgagtgtacggagcagtgcgcggggctgaggaag
agaccgtgtcacgaccccagcgcgcaaagtaagaggtcacgcagcagcccagatgaagtt
agttgtccaagcctgagccactctgttgaacacacacccagaaagtccagtcccaagaga
caaacgtga

DBGET integrated database retrieval system