KEGG   Cyprinodon variegatus (sheepshead minnow): 107097924Help
Entry
107097924         CDS       T06110                                 

Gene name
usp1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 1
  KO
K11832  ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107097924 (usp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cvg01002]
    107097924 (usp1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cvg04121]
    107097924 (usp1)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107097924 (usp1)
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     107097924 (usp1)
Peptidases and inhibitors [BR:cvg01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   107097924 (usp1)
Ubiquitin system [BR:cvg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    107097924 (usp1)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107097924 (usp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 107097924
NCBI-ProteinID: XP_015250768
Ensembl: ENSCVAG00000005956
UniProt: A0A3Q2FJM4
LinkDB All DBs
Position
Unknown
AA seq 808 aa AA seqDB search
MSGLLTENTGAGQASPVKRNKLSLKFFQKKETKRALDFSEAQTEEDKTEEQADSVASCEQ
VVYGPAPCPSSPGLAIAIPHEKKENLVPFVGLNNLGNTCYLNSILQVLYYCPGFREGVKK
LYDLSKSRERAKDENDKDEKPQRQQSECASGTLPANIELLGSFNSLITSIEQLQSSFLLN
PEGFSDGELATPPRKILHTIRQLNPMYEGYLQHDAQEVLQCILGYIQEACDTIRKEQELE
KDDGDVKTQNSSPSDFSCSGTQSKASADEDGQVSGKRKSDTEVGNAKKKPKSAKSKKSES
AEEDLSRNKHFTRSKRKSSSETLMESAQSKDGEEEKAKNLNEEEGNEGGKVDKAATKETR
GKRKIKATLGWLRSSGKQPSIFSKFCSVGKISSTAVKNLIKSEQENGPSEEPKERSAPQS
ASVTSAEGKTEKRQDALGLMEKLFQGRLVLRTRCLECESFTERREDFQDISVPVLDDQPS
SPEDLSEVSPDPKPEMKTLTWAISQFASVERIVGEDKYFCETCHHYTEAERSLLFDKTPE
VITIHLKRFSTSSLELDPYAGLSKVNTPLQTPLTLSLKEWCTKPSAAMQQQYDLFAVVMH
SGVTISSGHYTTYIRMSDLKEAKVWQQDDKEREMEEEVKENKGGVLKEENLAYDDGEVSV
SLSTRGQTRAGLANTKSGSKNLSEGSVGLLGGQRSLSNCELGSGRKAGSSGATEGSKRRR
TLNSSSQNTDGLKKEAEEAPVAPSGGREATEQQALSGLLQYEGKWLLFDDSEVRLFDEED
FLRACSPETCSSSTPYLLFYKRIPEPSQ
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtctactgacggagaacaccggagcagggcaggcgagtccagtaaagaggaac
aaactctccttaaagttcttccagaagaaagaaacgaaacgagctctggatttctctgaa
gctcaaacagaagaagacaaaacagaagaacaagcggattcagtggcaagctgtgagcag
gtggtctatggccccgccccctgtccatcttcaccgggactcgctatcgctatcccacat
gagaagaaagagaacttggtgccttttgttggtcttaacaaccttggcaacacctgctac
ttaaacagcatcttgcaggttctatattactgtcctgggttcagagaaggtgttaagaag
ttgtatgacctttccaaaagcagagagagagcgaaggatgaaaatgataaagatgaaaag
cctcagcgtcagcagtcagagtgtgcatctgggaccctgccagctaacatcgagctcctc
ggaagcttcaacagcctcataacttcaatcgagcagctgcagtccagcttcctgctcaac
cctgaaggcttcagcgacggagagctggccaccccgcctcgtaaaatacttcacaccatt
aggcagctgaaccctatgtatgaaggctatctccagcatgatgctcaggaggtcctgcag
tgcattctgggatatattcaggaggcctgcgacaccatcagaaaggagcaggagctggaa
aaggacgacggagatgtgaaaacacagaacagtagtccatcggatttcagttgctctggg
acacagtcaaaagcctctgcagatgaggacggacaagtcagcgggaagaggaagagtgac
acagaggtgggaaatgctaagaagaagccgaagtctgccaagtccaagaaatctgagtct
gcagaggaagacctcagtagaaacaaacacttcactcgctccaagaggaagtcctccagt
gagactctcatggaaagcgctcagagtaaagatggagaggaggagaaggcaaaaaacctg
aatgaggaggaagggaacgaaggagggaaggttgacaaagcagcaactaaggagacgcgt
ggaaaaaggaagattaaagccacactaggttggctgagatcgtcagggaagcagccaagt
attttttctaagttctgcagcgttgggaagatcagctccacagcggtaaaaaatctgatc
aaatcagagcaggaaaacgggccatcagaagagccaaaggagaggagcgctccccaatct
gcttctgtaacttctgctgaagggaaaacagagaaacgtcaagacgccctgggcttgatg
gagaagctgttccagggccgactggtgctgcgaactcgctgtctagagtgtgagagcttc
acggagcggagagaggacttccaggacatcagcgttcccgtgcttgatgaccaacccagc
agcccagaagacctctctgaagtctctccagaccctaaacctgagatgaagactctgacg
tgggccatctctcagtttgcctcggtggagcgcatcgtaggggaagataaatacttctgt
gaaacctgccatcattacacagaggctgagaggagtctgctgtttgataaaacccctgaa
gtcatcactattcacctgaagcgcttctccaccagcagcctagagttggatccatacgca
ggcctgtctaaagtgaacacccccttacagacaccgctgacgctgtctctgaaggagtgg
tgtacgaagccctctgcagccatgcagcagcagtacgacctgtttgctgtggtcatgcac
agcggcgtcaccatcagcagcggccactacaccacctacatccgcatgtctgatctgaaa
gaagcaaaggtctggcaacaggacgataaagagagagaaatggaggaggaggtgaaggaa
aataaagggggtgtactgaaagaggaaaatctggcctatgacgatggagaagtgtcagtc
agcctaagcaccagagggcagactcgagcaggtttggctaacactaaatcggggagcaaa
aacctttcagaaggtagtgttggactcctgggaggacagaggagtttgtccaattgcgag
ctgggaagcgggagaaaagcaggcagctctggagccacagagggatcgaaacgtaggagg
actttaaacagctccagccagaatacggacggattaaaaaaggaagcagaggaggcacca
gtggctccctctggaggcagggaggctacagagcagcaggctttgagcggcctgctgcag
tatgaggggaaatggctgctgtttgatgactcagaggtgcgtttatttgacgaggaggac
tttctgcgagcctgctcccccgagacgtgttcctcatcgacaccataccttctgttctac
aaaaggattcctgagcccagtcaataa

DBGET integrated database retrieval system