KEGG   Cyprinodon variegatus (sheepshead minnow): 107099560
Entry
107099560         CDS       T06110                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04012  ErbB signaling pathway
cvg04068  FoxO signaling pathway
cvg04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107099560
   04068 FoxO signaling pathway
    107099560
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107099560
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107099560
NCBI-ProteinID: XP_015253218
Ensembl: ENSCVAG00000011916
UniProt: A0A3Q2GI30
LinkDB
Position
Unknown
AA seq 164 aa
MCNKMSEVRLSNASPTVERVDARQPDSTRSVRRVLFGTPDPEETRRQAEALQQQAVDDFT
ERYNFDPVEDRPLSPGEYDWQEDGDAPEFYRRPPRGSRPPSGEAAYTSNGSRKRPAGNCS
EDCTSQKKKSHSDEDDDDKGAGSQRVQRASRPEEEDPSPPVPAQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtgcaacaagatgtcagaggttcggctttctaacgcgagtcccacggtggagcgcgtg
gacgcgcggcagccggacagcaccaggtcggtgcgcagggtgctgttcggcacacctgac
ccggaggagacgcgcaggcaggcggaggctctgcagcagcaagccgtggacgatttcacg
gagaggtacaacttcgatccggtggaggacaggccgctctctccgggggagtacgactgg
caggaggacggagacgcgccggagttttaccggaggccgccccgggggagcaggccgccc
agcggggaggctgcatacacttctaacggttcacggaaacgacctgcagggaattgctct
gaggactgcacgagtcaaaagaaaaagtcgcattccgatgaagacgacgacgataaaggt
gcaggaagccaaagagtgcagagagccagcaggccagaggaggaggacccgagccccccg
gtgccagcgcaatga

DBGET integrated database retrieval system