KEGG   Cyprinodon variegatus (sheepshead minnow): 107099870Help
Entry
107099870         CDS       T06110                                 

Gene name
faap100
Definition
(RefSeq) Fanconi anemia core complex-associated protein 100
  KO
K10993  fanconi anemia core complex 100 kDa subunit
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107099870 (faap100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107099870 (faap100)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     107099870 (faap100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FANCAA CNH
Motif
Other DBs
NCBI-GeneID: 107099870
NCBI-ProteinID: XP_015253634
LinkDB All DBs
Position
Unknown
AA seq 843 aa AA seqDB search
MFLAVMEGRCAAECWADFGVLLKPGTPLLKRASGTNVFICTGSDEVYVFTTEEKKIKAVV
RLPAPLKDLVVSHDEQFLLVACSNGIYSVNLQLLSESTSCDAGSGITELDVTSESLIAVA
EGLSSFLLVGSLLLTFCQTDTSWLLTLYKTQGQSQSHTCDLISSFSLPLVSPSVQSHMES
KSVLICVYCGNATPLSYSPTASDAGSSCRHFLLQPVLFKLLFGVEAALAKSPVVLCGLPD
GRLCFLPLRLPGSRLQVLHSLEQPVVFIGASAVMETDAGCAAALVALGKQGRVLLMEAGR
AGSGREGGIASYSKGSILGPVECACVDKSCLYYSTGSDLLALALSEGSAGRERKEDEEAS
GSRDAFFYRPDSLNVSGVVALDQPTCNAAGEAQLLSLSVRGQLWRISVPIKTRGEGLSTL
CSSQIGRSVGDLLSAIGNVCERASVLKTSIGSKNQILKQLNEVINISFLLTDSPNPEDKP
IRCRGLVRWSRLLDKDSLDLTCFLENLSPYLLERGWTLSVLLHPLSSFPKAGEGTCSANY
SFPFHSLHPGDSLRVCVPVMAAGDASIPVTVTCSLIFSLRSFLGGKGETSFSGLHNGCFS
LPLNTLMVDWLHALRMIGPSSAQSTYISPSNSNQADAIQAFISSRQMGCREGDGSSRTGG
YSATVRMSSDLLRLQRSKDPKLAPQRSCVSLLEWLLSESCGGVKIGHKEEKMDRISSVVC
GRAPNEAPIKLTAKEVNVEEESSGKEEPPVSVEIKVESPSAAAVCGLHHAVLLRIQTLLQ
KAPEKACFSIKEESSGLRQTLQRAESQRGQISEALSVGMSSGQMHQILLSVYQQLRDSPL
LIV
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagcagtgatggaggggcggtgtgctgctgagtgttgggctgatttcggtgtg
ttattaaagcctggtacgccgctgcttaaacgtgcttctgggactaatgttttcatctgc
accggcagcgatgaagtatatgtcttcactacggaggagaaaaaaatcaaggcggttgtt
cggcttcctgctcctttgaaggatctggttgtcagccatgatgagcagttcctgttggtg
gcatgcagtaacggcatctactctgtcaatctccagctgctttcagaaagcacatcctgt
gatgcaggttctggtatcactgagctggatgtcacctcggagtcccttattgctgttgct
gaaggcctgtcgtctttcctcctcgtcggctcgctgctcctgaccttttgccaaactgac
acttcctggttgttgactttgtataaaacccaaggacagtcccagtctcacacctgtgac
ctgattagctccttctccctgcctcttgtctcaccttctgttcaaagccacatggagtca
aaatctgtgctgatttgcgtttattgtggcaatgcgactccgctgtcttattctcctaca
gcatcagatgcaggttcatcttgtcgccacttcctccttcagccggttctcttcaagctt
ttgtttggggtggaagcggcgctcgccaagtctccagttgtactttgcggcctgccagac
ggacgcctgtgctttctccctctgcgcctcccaggatcccggctgcaggtcctccatagc
ctggagcagccggtcgtgtttattggagcatctgctgtcatggaaactgatgcgggttgc
gctgcagccttggtagctctgggcaaacaaggcagagtgttgctgatggaagccggcagg
gctgggtcagggagagaaggcggtatcgccagttattctaagggctctatcctcgggcct
gtggaatgcgcctgtgtggataaaagttgtctttactacagcaccggatccgaccttctt
gctctggctttgtcagagggttctgctgggagggaaagaaaagaggatgaggaggcatct
gggtccagagatgcttttttctacagacctgacagtttaaatgtgagcggagtcgttgct
ttggatcagcctacatgcaacgctgcaggtgaagctcagctgctcagtttatctgtcaga
ggtcaactgtggaggatcagtgtccctattaagacacggggggaaggtttgtccacgctt
tgctcctcacagattggccgcagcgttggagatctcctgtctgccatcggtaatgtctgt
gaaagagcatctgtgctgaaaacctccattggatctaaaaatcagattctcaagcagctg
aatgaagtgattaatataagcttcctgctgacggacagtcctaacccagaagataagcct
atcaggtgtcgtggtttggtaaggtggagccggctgcttgacaaagactccctggatctc
acgtgtttcctggagaatttgagtccctacctcctggagcgaggttggactctgagcgtc
ctgctccaccctctgtccagttttccgaaagcaggagagggaacctgctctgcaaattac
tcctttccgttccacagtctgcatccaggggactctttgagagtatgtgtgcccgtcatg
gctgcaggtgatgcatccatccctgttacagtgacctgctcgctcattttctccctccgg
agttttctgggaggaaaaggagaaacgtccttctctggtttacataatggctgtttcagt
ttgcccttaaatacactgatggtggactggctgcacgccctccggatgattggcccatcc
tctgcgcagagcacatatatatcaccatccaacagcaaccaggcagatgccatccaggcc
tttataagctcgcggcagatggggtgcagagaaggagatgggtcttccaggacagggggg
tattctgccactgtccgcatgtcatcagacttactaagactgcaaagatccaaagaccca
aagttggcccctcagaggtcctgtgtctctttgcttgagtggctgttgtctgaaagttgt
ggtggagtgaagattggccataaagaagaaaagatggacagaatcagctctgtggtctgt
ggccgtgcaccaaatgaagccccaattaaactcactgcaaaagaggtaaacgtagaggag
gagagttctgggaaggaggagcccccggtcagtgttgagattaaggttgagagcccatcg
gcagcagctgtctgcggcctgcaccacgccgtgctgcttcgcattcagactctgctgcag
aaagctcctgaaaaagcctgtttctctataaaggaagagagttctggtttgagacaaact
ctacagcgagctgagtctcaacgaggtcaaatctcagaggcgctgagtgtgggcatgtcc
tctgggcagatgcatcagattctcctcagtgtttaccagcaactcagggacagtcctctc
ctcatagtctaa

DBGET integrated database retrieval system