KEGG   Cyprinodon variegatus (sheepshead minnow): 107099895Help
Entry
107099895         CDS       T06110                                 

Gene name
rev1
Definition
(RefSeq) DNA repair protein REV1 isoform X1
  KO
K03515  DNA repair protein REV1 [EC:2.7.7.-]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107099895 (rev1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107099895 (rev1)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     107099895 (rev1)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    107099895 (rev1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS REV1_C IMS_C BRCT_2 IMS_HHH BRCT LIG3_BRCT UBM PTCB-BRCT DUF1805 Cdd1
Motif
Other DBs
NCBI-GeneID: 107099895
NCBI-ProteinID: XP_015253673
Ensembl: ENSCVAG00000018356
UniProt: A0A3Q2G1C9
LinkDB All DBs
Position
Unknown
AA seq 1355 aa AA seqDB search
MSRDGWMKKRANASDDNGWEERGGYMAAKVSKLDEQFKLNATREKQKEGTSSSIFSGVAI
YVNGYTDPSADELRRLMMLHGGQFHVYYSRSKTTHIIASNLPNCKIQELRGEKVIRPEWI
TDSIKAGRLLPYLKYQLYAKQKNTLFPGVVLRHASEMSEPSHCPLQPNMHQKPLLPAHNT
EPSVPPSGGSSNSSFTVPGFNDAEPQSIHQISKANLDYRQQGNLKSSQLVADSLPVSGSL
HRNHLSNKGHIKHPHKSPSSAHMHGEDLKVNGVPQTSLETSSHSNMKEMQERGDPCPYGA
SVVVEEAPLTNGHAHHFNGALKPKDLFPVANPSSSVRDESTCRAKSPTEKPQSPTVQSHT
KPDPYEFPPSPPKQSDSLPVLSELSGSHQEGAYGSKPLLSSHEALKASKPHPPLKCLQPP
SQVESISEPTAQTPASRSHSHSAVRLNGSHHKVYPSDPQPLNNVTAKPDPSTSTSSDQLL
DQTGGLISEFYSHSRLHQISTWRIAFSEYVNELHSKRKTEGSPSYSGKERLRKSMGQRST
HGQGTSVAASVKSCIFHIDMDCFFVSVGIRHRPELKGKPVAVTSNRGLGKVPVRPGANHQ
VELQYYQRKHTHPQPETADDDLSVTPSQDTPNSYGNGVDQDAAALSMAEIASCSYEARQA
GIRNGMFFGKAKQLCPSLQSVPYDFDAYKEVALNLYEILASYTCDIEALSCDEALIDASS
LLAEVGVSPDDLAKAIRADIEEKTGCCASVGMGSNILLARLATRKAKPNGQYFLRSEEVD
DFIRDLPVTSLPGVGHVMAKKLAVMGVKSCGDLQQVPLSQLQKKFGPRTGQTLFRFCRGL
DDRPVRFEKERKSVSADMNYNIRFTTVDEAECFLTNLSMEVQRRLKEAGLRGRRVTLKVM
VRKVGAPLEPAKYGGHGICDNLAKTVMLAQSTDSGQLIASAVIKLLHAMKLQVQDLRGVG
IQVQQLEGNQLQGQDCRAPRTRSIKDMLLGQGLNAQTNNKAAAGTPSEQTSAAPVHSSRS
SPHPLTPGEPVPGTSKDTPVCKQTPKHPRTRLNFSIEIPSPSQVDRSVLEALPAELRLQV
EQSWTKTDERPNHCVSPDLQLPSPNPCPALNAPPPGTLVLQLPNQPDTLGIVLELPNFSQ
VDPDVFAALPKELQDELKSAYSRANNIQPQVKTAEQKNPLLQLKPAVVGAAVGRVKRRYK
RKNGVSPVKKVTSPLKRRQVMNSPAKNILPMKPQEPAKINPSAAEQNVLVSVTKSVPRPV
PTLAGACDLRDIKTLLREWVTTITEPMEEDILQVVKYCTDLIEDKDLEKLDLIIKYMKRL
MQQSVESVWSMAFDFILDNIQVVVHQAYGSILKIT
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgatggctggatgaaaaagagagccaatgccagcgatgacaatggttgggaa
gagaggggcggctacatggctgccaaggtttctaagctggacgagcagttcaaactcaat
gccaccagagaaaagcagaaggagggaacaagctccagcatcttcagtggggtggctatt
tatgtcaatggatacacagatccaagtgcagatgagctccgcaggctgatgatgctgcat
gggggtcagtttcatgtctattactcgcgctcaaaaaccacacacatcatcgctagcaac
ctgcccaactgcaaaattcaggagctccgaggggaaaaggtcatcaggccggagtggatc
actgacagcattaaggccggccgtctcctgccttacttgaagtaccagttgtatgctaaa
cagaagaacacgctcttccccggcgttgttctgcgccacgcctcagagatgtcagaaccg
agccactgtccccttcagccgaacatgcatcaaaagccccttttgccggcgcacaacact
gagccctctgtcccccccagtgggggctcctcaaacagctcctttactgtccccggcttt
aacgatgctgagcctcagtccatccaccagatctccaaagctaacctggattaccgccag
cagggtaatttaaaatccagtcagctggttgcggattcccttcctgtgagcggatcttta
caccggaaccacctttccaacaagggtcacataaagcatccgcacaagtctcccagctct
gctcacatgcatggagaagacttaaaagtgaacggagttccacagacctcactggaaacc
tcgagccattctaacatgaaggaaatgcaagagcgtggcgatccatgtccttacggggcc
tcagttgtcgtggaggaagccccgttgaccaatggacacgctcatcatttcaacggtgcc
ttaaagccaaaggacttgttccctgttgcaaatccatcctcctctgtcagggacgagtcc
acatgtagagcgaagagtccaacagagaaacctcagagtcctacagtgcagtcacatacc
aaacctgatccatacgagttcccccccagccctccaaagcaatcagactcacttcctgtc
ctttcggagctatccggctcacatcaagaaggcgcttatggatctaaacctttgttatcc
tctcacgaggctttaaaagccagtaaaccccacccccctctgaaatgtctccaacctccc
tctcaggttgagtccatttctgagccgactgctcaaactcctgcatcccgttctcattca
cactctgcagttagactgaatggtagtcaccacaaagtttatccatctgacccccaaccc
cttaacaatgtaactgcgaagcccgatccttcaacctccacttcttcagaccagctgctg
gatcagaccggcgggctgatatcggagttttactctcattcccgtttgcaccagatctcc
acctggaggattgctttctccgagtatgtcaacgaacttcacagcaaacgaaaaacggag
gggagcccgtcctattctgggaaagagcgactgaggaaatctatgggtcagcgatccacg
catggacaaggcacatcagtagcagccagtgtaaaatcgtgtatcttccacattgacatg
gactgcttttttgtgtctgtggggatccgacatagaccagaacttaaagggaagcctgtc
gctgttaccagtaaccgtggactgggcaaagtcccggtcagacccggagctaaccatcaa
gtggagctgcagtactaccagaggaaacacactcatcctcagccagagacagcggatgat
gatctgtccgtaactccatcacaagacacccccaactcctatggcaacggcgtggaccag
gacgctgctgctctgtccatggcagagatcgcatcttgtagttacgaggccaggcaggca
ggcattcggaacgggatgttttttggcaaagctaaacagctttgcccttcgcttcagtcc
gtcccgtatgatttcgatgcctacaaagaggtggctctaaacttgtacgagatcctggcc
agttacacctgtgacatcgaggctctcagctgtgatgaagcgctcatagatgcttcttct
ctgcttgctgaggttggcgtcagtcctgatgatttggccaaagccatcagagcggatatt
gaggagaaaacagggtgctgtgcttcagtgggaatgggttccaacattcttttggcccga
ctcgccacccgcaaggccaagccgaacgggcagtacttcctcaggtctgaagaagtggat
gattttatcagggacctgccggtgaccagtttaccaggtgttggccacgttatggccaaa
aaacttgctgtcatgggggtgaagtcatgtggggacctccagcaagtgcctctatcgcag
ctgcagaagaagttcggacctcgtacgggacaaaccctgtttcgattctgcaggggttta
gacgaccgacccgtccgttttgaaaaagaaagaaaatctgtttctgccgacatgaactac
aatatccgctttaccacggtcgacgaggcagagtgtttcctgactaatctctcgatggag
gtgcagcggcgtctgaaagaggcaggcctgcgaggtcgtagagttactcttaaggtcatg
gttcgcaaggtgggagcgcctctggagccggcaaaatacggcggtcatggcatctgtgat
aatctagccaagacggtgatgctggctcagtccaccgacagcgggcagctcatcgcctct
gctgtcatcaagctgctacacgccatgaagctgcaggtccaagacctgagaggtgtcggc
attcaggttcaacagctggagggaaatcaactccaaggacaggactgccgggctccacgg
acacgctccatcaaagacatgcttctaggccagggattaaatgcccaaactaataataaa
gctgcagcaggcactccttctgaacagacctcagcagcacccgtccactcaagtagatca
tccccgcatcctttgacgcctggcgagccagtccctgggacaagcaaagacacaccagtc
tgcaaacaaacgccgaaacatcccaggacccgcctcaacttcagcatagaaatcccttcc
ccctcccaggtggatcgttctgtcctggaggccctaccagccgagctgaggttgcaggtg
gagcagtcgtggactaagacagacgagagacctaatcactgcgtttcacctgatctgcag
cttccctctcctaacccctgtcctgccctaaatgccccccctcctggaacactggtgctg
cagttgccaaaccagccggacactctgggaattgtactggaactgccaaacttctcacag
gttgatccggatgtatttgctgcccttcccaaagaactacaggatgaactgaagtctgcc
tacagccgtgctaacaatatccaaccccaggtgaaaacggcagagcagaaaaaccctctg
ttacaacttaaaccagcggttgtaggagctgccgtcgggcgggtgaagcggcgctacaag
agaaagaatggagtgagtcccgttaaaaaagtgacttccccgttaaagaggcgacaagtg
atgaacagtccagccaaaaacatactgcccatgaaaccacaagaacctgctaaaattaac
ccctctgctgccgagcaaaatgtcttggtgtctgtgacgaagtcagtccctcgtcctgtt
ccgacgttggctggagcttgtgatttgagggacattaaaacactcctacgggaatgggtc
accaccataacagaaccgatggaggaggacatcctgcaggtagtgaagtactgcactgat
ctgattgaagataaagatctggagaagttggatttgatcatcaaatacatgaaaaggctc
atgcagcagtcggtggagtccgtttggagcatggcgttcgacttcatcttggacaacatc
caggtggttgtgcatcaggcttatggtagcatcttgaagatcacatga

DBGET integrated database retrieval system