KEGG   Cyprinodon variegatus (sheepshead minnow): 107101488Help
Entry
107101488         CDS       T06110                                 

Definition
(RefSeq) procollagen galactosyltransferase 1-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00310  Lysine degradation
cvg00514  Other types of O-glycan biosynthesis
cvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107101488
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107101488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cvg01003]
    107101488
Enzymes [BR:cvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107101488
Glycosyltransferases [BR:cvg01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107101488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25
Motif
Other DBs
NCBI-GeneID: 107101488
NCBI-ProteinID: XP_015255916
Ensembl: ENSCVAG00000006562
UniProt: A0A3Q2FKP4
LinkDB All DBs
Position
Unknown
AA seq 344 aa AA seqDB search
MYVCNRDNYGYFPVPMRSHASMQDEAESFVHTHLEIMVNHPPLEPSSFLSLPPKQPNKMG
FDEVFMINLVRRADRRERMLRTLYEQEISCKVVAAVDGKALNTSDIDSMGIKMLPGYKDP
YHGRPLTKGELGCFLSHYNIWKEIVERGLQTSLVLEDDLRFEVFFKRRLQALLQEVTTHK
VDWDLIYIGRKRMQVDHPEKSVPNTHNLVEADYSYWTLGYMLSLRGAQKLLMAEPLTKML
PVDEFLPVMYNKHPISKYMDHFENRDLQAFSAEPLLVYPTHYTGDPGYISDTETSVVWNN
ETVRTDWDRAKSRKTQEQGELSFEAQNSDVLQSELENVSARDEL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtatgcaacagagacaactacgggtatttcccagtgccgatgcgttcacatgcc
tccatgcaggatgaagcagagagctttgtgcacacacacctagagatcatggtgaatcat
cctccattggagccctccagcttcctttctcttcctcccaaacagccaaacaagatgggc
tttgatgaggtttttatgataaatctggttcggagagctgaccgtcgggagcgaatgctg
aggaccttgtacgagcaggagatcagctgtaaggtggttgctgctgtggatggcaaagct
ctgaatacgtctgatatagattctatggggattaagatgctccctggatacaaagaccct
tatcacggacggcctctcaccaagggggaactgggttgtttcctctctcattacaacatc
tggaaggagattgtggaacgcggcctccaaacatccctggtcctggaagacgaccttcgt
tttgaggtgttcttcaaacgccggctccaggcgctgctgcaggaagtgacgactcacaag
gtggactgggatctgatatacattggacggaagcggatgcaggtggaccacccagagaag
tctgtcccaaacacccacaacctggtggaggcggactactcctactggacgctcggctac
atgttgtccttacgcggagcccagaagctcctaatggctgaacctttgaccaagatgctt
cctgtcgacgagtttctgcccgtcatgtacaacaagcatccaatttcgaagtacatggat
cacttcgagaatcgggacctgcaagctttttccgctgagcctctcctggtgtatccgaca
cactacactggagatccgggctacatcagcgacacggagacgtcagtggtctggaacaat
gagacggtaagaaccgactgggatcgagccaagtcgaggaagacccaggagcagggggag
ctgagcttcgaggcccagaactcggacgtgctgcagtcggagctggagaacgtgagcgcg
cgcgacgagctgtga

DBGET integrated database retrieval system