KEGG   Cyprinodon variegatus (sheepshead minnow): 107101653Help
Entry
107101653         CDS       T06110                                 

Definition
(RefSeq) Fanconi anemia group A protein-like
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107101653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fanconi_A
Motif
Other DBs
NCBI-GeneID: 107101653
NCBI-ProteinID: XP_015256132
LinkDB All DBs
Position
Unknown
AA seq 427 aa AA seqDB search
MEVSNVSGGCRHRADLWDFLFEVVSQRCSPSSASITSKLGLQRSLHKWNRVLLSLPAVLF
FKIKSESGRTTVDCSRLVEHINKHQRKVCSPDSVLACSVTAHLLKGLLCAAVQCGRPGEE
VNRVWSQMSISCPLLVVSAVRWWQQLSPLLFSLWARLRNGESPPEQLQRLSDCWLWACSL
KRSQVAKMPEAAVLVCAASLHGSFCRGCEEQQQSFSDAVKSLKAERGAEYKQVLVSLLFL
CLKDYLSALLYPQEQSCEKSKHFCSELLAVLVNSADCLLIFSSNASSEPNRYPWVSLTSS
DDCIRLMPWALCSLLLQQSAEFLQRALCCPGFLHAAILWYLSVLQLFLEGDTPTMTTAPT
EKLDPSQVLNRTKQLVLSSISQVPPAALSSSQLRQLECQCADLDPELAAALSVLLNPHNL
SPEIDFL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagcaacgtttcaggcggctgcagacacagagctgatctttgggatttcctg
tttgaggttgtgtctcagagatgctctccatcctctgccagcatcacctccaagcttggt
ctgcagagaagcttacataaatggaacagagtgctcctgtccctcccagctgttttgttc
tttaaaataaagagtgaaagtggaaggaccactgtggactgcagcaggctcgtagagcac
atcaacaagcatcagaggaaggtgtgttctccagatagcgtgctggcctgctcggtaact
gcacacctcctgaagggtctgctatgtgcggctgtgcagtgtggacgccccggagaagaa
gtcaacagagtttggtctcagatgagcatcagttgtcctcttctcgtggtctctgcagtg
cgctggtggcagcagctttctccgctcctcttttccttgtgggctcgtctccgtaatgga
gagtctcctccagaacagctacagcgcctctcggattgttggctctgggcctgcagtcta
aagcggagtcaggtggccaagatgcctgaagctgctgttttggtgtgcgccgcgagcctg
catggctccttctgcagaggctgtgaggaacagcagcagagcttcagtgatgctgtgaag
tcactgaaagcagagagaggagctgaatacaaacaggttcttgtttctctgctcttcctt
tgcttgaaggactacctgtcagcacttctgtaccctcaggagcaaagttgtgaaaaatct
aaacatttctgctcagagcttctggctgttttggtgaattctgctgactgtctgctaatc
ttcagctccaacgcatcttcagaaccaaaccggtatccctgggtctccctgacatcttcg
gacgattgcatacggttaatgccctgggctctctgcagtttgctgctgcagcaaagtgct
gagttcctccagagggcgctgtgttgtccagggttcctccacgctgccatcctgtggtac
ctctctgtgctgcagctgttcctagaaggagacacgcccaccatgaccacagcacctact
gagaagctggatccctcccaggttctgaaccgcaccaaacagcttgtcctgagttcgatc
tcacaggtacctcccgctgcactctcctccagccagctgcgacagctggagtgtcaatgc
gcagacctggacccagaattggctgcagctctgtcggttttgctgaaccctcacaatctc
agccctgagatagacttcctttaa

KEGG   Cyprinodon variegatus (sheepshead minnow): 107101654Help
Entry
107101654         CDS       T06110                                 

Definition
(RefSeq) Fanconi anemia group A protein-like
  KO
K10888  fanconi anemia group A protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107101654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107101654
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     107101654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fanconi_A_N DUF5071
Motif
Other DBs
NCBI-GeneID: 107101654
NCBI-ProteinID: XP_015256133
LinkDB All DBs
Position
Unknown
AA seq 957 aa AA seqDB search
MSLSGFCGPVSQKRSVSSLLAGRVIKKPKHEDGQQLQEAAIQLLDQHQNLRSLFQELENK
EQNQAGSEANPNHISGWLLGSELRRRAEQLGVSVGVMSVKTVLERLTEITDGQEEMDENR
CREMLTSSQRMQLRVLLESTKELLSQGILCPKLLWMEHRRNQKNPKLELIYHLHLYNILT
LDSIIESDESVRSWLPRQVKALCGWTSPQDEEETTQILQKVLLMVAGVLVGAAFEIRPDL
AAPERKISLLCSSVLDDMLFWLLETEEKRDKGAEKWIQTFDASLCGAFVSPEALQRFFTH
CLTQIFTYNPRLTVSDAVTLQNGWTVGKTSPSLTSLYCKLAAIFSVEQLLQHLQQVLETH
EVNWKHVLCFVSSLLVYHQSAQPLKELLSRLLQSAFEGYDLEKMITAFLLARQGALEGAG
IFLSYSDWFKMSFCGSTGCHASSKKSLVFLLKFLSDLVPFEPPQYLKVHILHPPYVPAKH
RGLLMEYITLAKTRLADLKEPVEDMGLYEDVSSGGASVQCQAAQDVEKAVSLFESTGRIS
ATVMEASIFRRPYFLTRFLPALLKPRVLPLKPDAQMNFIEALKKADKIPAAQYSSYVESC
QKQRQQNKTAAHSDTKEDPFDILKVQLRDFTELVVGGNNGEMSAQLSRISHTLSVIFPGS
PDELMRQTVVTLNTDCTQLPELHVKVVNLILRTFCQSLLNASRGNPPNKQCSWGCRFVSL
LLDNRHLLSSVAHRLWDLFHNQGASLSALHILGLAAFMVHIQASMAEGPLVQLVPHRQHQ
PVPLADALSSAVLCNTHINMLFSVRLGVAAVCYGLCRGDSPSPQQQQQEYIPSSLYKKLL
YLIPRLFPEARRSSGSVCPDEQQDGSDPLWSSITHDLSNWKKTVLNLWKHAAFQQLEQMP
QFRLCFSEWLNYELRVQRHEDILSDSQRYDEELTDASKETRAQPHFCSHSAPRDRLM
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcagtgggttttgtgggccggtgtcgcagaaacggtctgtgtccagtcttctc
gctggccgtgtgataaagaagccaaagcatgaagatggtcaacagctgcaggaggcagcg
atccagctgctggatcagcatcagaacctccgcagcctcttccaggagctggagaataaa
gagcagaaccaggcaggatctgaggctaaccccaatcacatctcaggatggctgctgggg
agtgagctgaggcgtcgggctgaacagcttggtgtctctgtgggagtgatgtcagtaaaa
acagttttggagagactgacagagatcactgatggacaggaagaaatggatgagaacaga
tgcagagagatgcttacatcctctcaaagaatgcagctccgtgttctgttggagtccacc
aaagagctgctttctcaaggaatcctttgccccaaactgctctggatggagcacagacga
aaccagaaaaatcccaaactagagttgatttaccatcttcacctttacaacatccttaca
ttggactccatcatagagagtgatgaaagtgtgagatcatggctgccacgccaggtgaag
gctctgtgcggctggacgtcgccgcaggacgaagaagagacgacacaaatcctccaaaaa
gttttgttgatggtggctggagtcttggtaggagcagcgtttgagatcagaccagatctg
gcagctccagaaaggaagatctcactgctgtgcagctcagtgctggatgacatgctgttc
tggcttctggagacggaggaaaaacgtgataagggagcagagaaatggattcagacattt
gacgcatccctttgtggagcttttgtgtcaccagaagccctgcagcgtttcttcactcac
tgcctcacccagattttcacctacaaccctcgactgacagtatctgatgctgtaacctta
cagaatggatggactgtgggaaaaaccagccccagccttacctcgctttactgcaagctg
gctgccatctttagcgtcgagcagctgctgcaacacctgcagcaggtcctggaaacccac
gaggtcaactggaaacatgtcctgtgctttgtctcctccctgctggtttatcatcagtca
gctcagcccctcaaagagttgttgtcccgactgctgcagtctgcgttcgaaggctatgac
ctggagaaaatgatcacagccttcttgttggctcgacagggagctctggagggcgccggc
atctttctgtcttacagcgactggttcaagatgtccttttgcggctctactggctgccat
gctagcagtaagaagtctctcgtgtttctgctgaagttcctctctgacctggtgcccttt
gagcctccacagtatcttaaggttcatatccttcatcctccttatgttcctgctaaacac
cgtggcctcctcatggagtacatcactctggcaaagaccaggcttgctgacctcaaggag
ccggtggaggacatgggtttgtatgaagatgtttcttctggaggtgcatcagtgcagtgc
caggctgcacaggatgtggaaaaagcagtgtctttgtttgaaagcacaggcaggatctct
gctaccgtcatggaggccagtattttccggaggccatactttttaacccgattccttcct
gctttgctcaagccaagagtgctcccactaaaacctgatgcgcagatgaatttcattgaa
gctctgaaaaaagcagataagatcccagctgcccagtattcatcgtatgtggagtcctgt
caaaaacaaaggcagcaaaacaagactgctgcacattcggacactaaagaagatccattt
gacatcctgaaagttcagctgagggacttcacagagctggttgttggaggaaacaatgga
gagatgtcagctcagctgtccaggatctcccacactttaagcgtcatctttcctggttcc
cctgatgagctcatgaggcaaacagttgtcacgctgaatacagactgcacccagttgcct
gagcttcatgtaaaagttgttaatttaatcctgcgaactttctgccaaagcctgttgaac
gcttctcgaggaaatcctcctaataaacagtgttcgtggggctgcaggtttgtcagcttg
ctgcttgacaacagacaccttctctccagcgtagcacacagactctgggacctgtttcac
aatcagggagcttcattgagtgctttacacattcttggcctggcagccttcatggtccac
attcaggcctccatggcagaaggtcctctggttcagctggtgccacacaggcaacatcag
ccagtacctttggctgatgctctcagctcagcagttctttgcaacacacacatcaacatg
ctcttctctgtcaggctcggtgtggctgctgtgtgctatggactctgcagaggagactca
ccatctccacagcagcagcagcaggagtatatcccaagcagcctttataaaaagctgttg
tatctcattccaaggttgttccctgaggccagaagaagctctggatctgtttgccctgat
gaacagcaggatggttcagaccccctgtggagcagcatcacacatgacctaagtaactgg
aagaagactgtcctgaatctctggaagcatgctgccttccagcagctggagcagatgcca
cagtttaggttatgtttttcagagtggctgaattatgagcttagagtccaaagacatgaa
gacatcttgtcagactctcagcggtatgacgaggaactcactgatgcttctaaagaaaca
cgcgcgcagcctcatttctgctctcactcggcgccacgggatcgactgatgtaa

DBGET integrated database retrieval system