KEGG   Cyprinodon variegatus (sheepshead minnow): 107101656
Entry
107101656         CDS       T06110                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107101656
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107101656
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cvg04052]
    107101656
   00536 Glycosaminoglycan binding proteins [BR:cvg00536]
    107101656
Cytokines and growth factors [BR:cvg04052]
 Growth factors
  Growth factors (RTK binding)
   107101656
Glycosaminoglycan binding proteins [BR:cvg00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107101656
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107101656
NCBI-ProteinID: XP_015256138
Ensembl: ENSCVAG00000018767
UniProt: A0A3Q2DAY1
LinkDB
Position
Unknown
AA seq 160 aa
MSHLLRPGIIPAEDRVMDGGPTLRDYRRPIRLYCMNGGYHLQILPDGTVWGQRDERDIHT
VVKLQAVDRGVVVIQGTAAERYLAMSAEGRLYASPTVTDECFFLEKLEENHYNTYQSQRY
QDSSWYVGLKKNGRTKLGPRTHIGQKAIFFIPRQLEVSQD
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagccacctgctgcgccccgggattatcccagccgaggatcgggttatggacggcggc
cccacgctgcgggactaccggcggccgatccggctgtactgcatgaacggcggataccac
ctccagatcctccccgatgggacggtgtggggccagagggatgagcgagacatccacact
gtggtgaagctccaagctgtggacagaggcgtggtcgttatccagggaacagcagcagag
cgatacctggccatgagtgctgaaggacgtctgtatgcctcacccacagtaaccgatgag
tgcttcttcctggagaagctggaggagaatcactacaacacatatcagtctcagagatac
caggacagcagctggtacgtcggcttgaagaaaaacggcagaaccaaactgggtccgagg
acccacatcggacagaaggccatcttcttcattcccagacagctggaagtttcccaggat
taa

DBGET integrated database retrieval system