KEGG   Cyprinodon variegatus (sheepshead minnow): 107101915
Entry
107101915         CDS       T06110                                 

Definition
(RefSeq) tomoregulin-2-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107101915
   04012 ErbB signaling pathway
    107101915
SSDB
Motif
Pfam: EGF S_locus_glycop Laminin_EGF DUF872
Other DBs
NCBI-GeneID: 107101915
NCBI-ProteinID: XP_015256488
Ensembl: ENSCVAG00000009914
LinkDB
Position
Unknown
AA seq 255 aa
MTRIFWDAIFLISGSFFSFGAGPSGSSVIEGNISITSAPGTSSHSSMVISDKGNTTANFL
TVKSSLDSSEAEQRNTTVKIFTATLNSSAAVTYMTSSSSATSSTSLTTRKPAATTSKHPV
KKFVAAAVRSHFSDCPDSHQHFCFHGTCRFLILEETPACVCHPGFVGMRCEHADLLAVVA
TNHRKQAVATALVLCVIGCVLIMVLCSFLHCWWREDCRRQSRSHLYLAEKHGVACYPPES
GTYPSFFMWFDKTSC
NT seq 768 nt   +upstreamnt  +downstreamnt
atgactcggattttctgggatgccatattcctaataagcggttccttcttctcatttgga
gcagggcccagcggttcatctgtaattgaaggcaatatttctattacctctgctccaggc
acatccagtcacagctctatggttatcagtgacaaaggcaatactacagctaactttctt
acagtaaaaagttctcttgattcatcagaagcggagcaaagaaatacaacagtaaaaatt
tttacagctactcttaattcctctgctgctgttacttatatgacaagcagctcctcggcg
accagcagcacaagtttgacaaccagaaaacctgctgcaacgaccagcaaacatccagtt
aaaaagtttgtggctgcggctgttcgctctcatttcagcgactgtcctgactcccatcag
catttctgctttcatggcacttgccgcttcctgattctggaggagacgcctgcatgtgtg
tgtcatccaggatttgttgggatgaggtgtgaacatgcagacctgctcgctgtggtagca
acaaaccacagaaagcaggccgtggccacagctctggtcctgtgtgtgatcggctgtgtc
ctcatcatggtgttgtgttctttcttgcactgctggtggagggaggactgccggaggcag
agccgatcacatctctatctggcagaaaagcacggagtggcatgctatccccctgagagt
ggtacttatccctctttctttatgtggtttgacaagacatcttgctga

DBGET integrated database retrieval system