KEGG   Cyprinodon variegatus (sheepshead minnow): 107101948
Entry
107101948         CDS       T06110                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107101948
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107101948
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cvg03310]
    107101948
Transcription factors [BR:cvg03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107101948
Nuclear receptors [BR:cvg03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107101948
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107101948
NCBI-ProteinID: XP_015256533
Ensembl: ENSCVAG00000018781
UniProt: A0A3Q2EF32
LinkDB
Position
Unknown
AA seq 764 aa
MDQGGVKKIVYRRNDHLSKLVYTESPEEGGLLKVAPHSAMSITSPPSVVLPSSPLMQPGQ
VTNGLSNSPLPEELASAPATIGSLVENSETRGPTKDQRPVELQLFQTQTSNTFGHQVLPQ
LDASMADITQSSMDSLIGGSDPNLFAVKTEDFSMDKGEQDPNDLDHAFDHIGKDVDMNQK
LFNETSLDLLQEFDLTASPSDFYVGEDAFLSTLADDSLLTEGEMRGISERDMKPAAESVN
TSGSKVTSSLESSTSVSKSASLTPTTTFPAVVKKEKDTSYIQLCTPGVIKQEKTSVGYCQ
MGDSNPISICGVSTSGGQSYHFGINASNNDALREKDQKPVSGLFLPVTTIGGAWNRNQND
SSAVRRAGDVFSTSPSFSSSFASSISRHEGGTPTSTTQGKSGTHKICLVCSDEASGCHYG
VLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKTK
KLNRLKGSQNSNPPEMMPSPPVEARSLVPKCMPQLVPTMLSLLKAIEPDTIFAGYDGTLP
DTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSY
QQCNGNMLCFAPDLVINEERMKLPYMAEQFEQMLKISSEFVRLQVSHEEYLCMKVLLLLS
TVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMGSGLL
SFCFYTFANKFLSVEFPEMLAEIISNQLPKFKDGSVKPLLFHQK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggatcaaggcggagtgaagaagatagtctacagaagaaatgaccatctaagcaaactg
gtctacactgaaagccctgaggagggaggtcttctgaaagtggctcctcacagtgccatg
tccatcacctctcctccttctgtcgttcttccatccagtcccttaatgcagcccggacag
gtgaccaacggcctcagcaacagcccgctcccagaggagctggcctcagctcccgccact
atcggctccttagttgaaaactcagaaaccaggggcccaaccaaagatcagaggcccgtg
gagctgcagttgtttcaaactcagacttccaatacttttgggcatcaggtcctgcctcag
ttggatgccagcatggcagatattacccagtcctccatggattcactcattggagggtca
gatcccaacttatttgctgtgaaaactgaggatttctccatggataaaggcgagcaggac
cccaatgatctggaccatgcctttgaccatattggtaaagatgtggacatgaaccagaaa
ctgttcaacgaaaccagtctggatctccttcaagagttcgacctgaccgcatccccgtcc
gatttttacgtcggggaggacgcctttttgtccacactggcggacgattctttgctcacg
gaaggagagatgagagggatatccgagagggacatgaaacccgcagccgagagcgtcaac
acgtccgggagcaaagtgacaagctcacttgaatccagcaccagtgtgtccaagtctgcc
tctttaacccctacaaccactttccccgccgtggtgaaaaaagaaaaagataccagctat
attcagctctgcacgccgggcgtgattaagcaggagaagacgtctgtgggctattgtcaa
atgggtgactcaaaccccatctctatctgtggggtgagcacctcaggggggcagagctac
cacttcggaatcaacgccagtaacaacgacgctctgcgggagaaggaccagaaaccagtg
tctggcctgttcctcccagtaacgaccatcggtggagcctggaacaggaaccagaatgac
agctcagcagtgcgcagggccggcgacgttttctccacatctccctccttctcctccagc
tttgccagttccatctccagacacgaagggggcactccaacatccacaacacagggaaaa
agcgggactcataaaatctgcctggtgtgttctgatgaggcttcaggctgccattatgga
gtcctcacctgcggcagctgcaaggtcttcttcaaaagagcagtggaaggtcagcataac
tacctgtgtgctgggaggaatgactgcattatcgacaaaatcaggagaaagaactgccca
gcctgccgcttccgcaaatgtctgatggcaggaatgaacctggaggctcgtaaaaccaag
aagttgaatcgcctaaagggaagccagaacagcaacccgccagagatgatgccttcaccg
ccggtggaagctcgctccctggtgcccaagtgcatgcctcagctcgtccccaccatgctc
tccctgctgaaggccatagagccagacaccatctttgccggatatgacggcacgctccca
gacacctccacgcgtctcatgaccaccctgaacaggctgggagggcggcaggtcatctct
gctgtgaagtgggccaaggctctgccaggtttcaggaacctgcacctggatgaccagatg
accctgctgcagtgctcctggcttttcctcatgtctttcggcctgggctggaggtcttac
cagcagtgcaacggcaacatgctctgcttcgcaccagacctggtcattaatgaggagcgg
atgaagctgccctacatggccgagcagttcgagcagatgctgaagatttccagcgagttt
gtccgactgcaggtttcccatgaggagtacctgtgcatgaaggtcctgctgctgctcagc
acagtgcctaaggacggcctgaagagccaggcggtgttcgatgagatccggatgtcctac
atcaaagagctaggaaaagccatagtgaaacgtgaggagaactccagccagaactggcag
cgtttctaccagctcaccaagctgttggactccatgcatgagatgggtagcggattactc
agcttctgcttctacacctttgcgaataaattcctgagcgtggaattccccgagatgctg
gcggagatcatcagcaatcagctaccaaaattcaaggatgggagcgtcaagcctctgctc
ttccaccagaagtga

DBGET integrated database retrieval system