KEGG   Cyprinodon variegatus (sheepshead minnow): 107102912
Entry
107102912         CDS       T06110                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 107102912
NCBI-ProteinID: XP_015257855
Ensembl: ENSCVAG00000014874
UniProt: A0A3Q2FX06
LinkDB
Position
Unknown
AA seq 351 aa
MTNCELIELKDLSVNDPIELAAPSAHTGQPGLDHIVRLVGDCVSFEGPARPPPEGAVGHD
FQPYSYTHLTWCDLCGEFIWGLYKQSLRCADCNYTCHYRCRPFIQLDCSKRGSVLKGNAD
YSEDAIETDTNVDEQIELGKQELSVGEIEQKVKEYNTQIINNLFMVDNKDGSYTGFIKVH
FQLLRPISLPPSQSQSRTEEDNQLDRPAKRRTSFYLPKDAAKHLHLSSETRVREVIEALL
NKFTVVDNPAKFALFEKVEKQSQVFLRKLSDEERPLYLRLCAGPNESALSLVLKENETGD
VNWDAFSFPELNNFLRILQREEDEHVRQIVKRYAHARDMIKHAMARVTTPG
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgactaactgtgagctgatcgagctcaaggacctgagtgtgaacgatcccattgagctg
gccgctccatctgcacacacaggccagcctggccttgaccacattgtccgtctggtagga
gactgtgtcagcttcgagggaccggcccgtccccccccagagggtgctgtgggccatgac
tttcagccctatagctacacgcatcttacctggtgcgacctgtgtggagaatttatctgg
ggtctctataagcagagcctgcgctgtgctgactgcaactacacttgtcactaccgatgc
cgaccgttcattcagctggactgcagcaaacgtggaagtgtgttaaaggggaatgctgac
tacagtgaggacgccattgagacagacacaaatgtggatgagcagattgaactgggcaaa
caggaactaagtgtcggggagattgagcagaaggtgaaggaatacaatactcagattatc
aacaatctcttcatggtggataacaaagatgggagctacactggttttataaaggtccac
tttcagttgctgcgccccatttcccttcctccatctcagagtcagagcaggactgaggaa
gacaatcagctggacagacccgcaaaacggcggacatctttctacctcccaaaagatgca
gcaaagcaccttcatttgagctcagaaactcgagtgcgagaagtcattgaggcgttgctc
aacaagttcactgtggtggacaatccggcaaagtttgccttgtttgaaaaggttgaaaag
caaagccaagtgttcctgcgtaagctgtctgatgaagagcggcccctgtatttgcgcttg
tgtgccggccccaacgaatcagccctaagtttggttttgaaggagaatgaaactggggac
gttaattgggatgcattcagttttcctgagctgaacaactttctgcgaatcctgcagcgc
gaggaagatgagcatgtgcggcagattgtgaagcgctatgctcatgctagagacatgata
aagcatgccatggcccgggtaactacccctggttga

DBGET integrated database retrieval system