KEGG   Cyprinodon variegatus (sheepshead minnow): 107103120Help
Entry
107103120         CDS       T06110                                 

Definition
(RefSeq) structure-specific endonuclease subunit slx1-like
  KO
K15078  structure-specific endonuclease subunit SLX1 [EC:3.6.1.-]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107103120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107103120
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     107103120
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     107103120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIY-YIG T5orf172
Motif
Other DBs
NCBI-GeneID: 107103120
NCBI-ProteinID: XP_015258136
Ensembl: ENSCVAG00000008625
LinkDB All DBs
Position
Unknown
AA seq 210 aa AA seqDB search
MVVEVESFYGVYMLYCTNPKFKGRIYIGFTVNPERRIGQHNAGRHKGGAKRTSGRGPWEM
VLIIHGFPSDIAALRFEWAWQHPHSSRRLSHVSRRSKKESSLQFHWRVVSNMLRVAPWSR
LPLTARWLRQEYRMDFDPGLQPPLHIPIAFGSVRAKKKLPSPSAGEELMNTCFLCKKMAT
VRVVMKSGGWGIKLLLHIWLIQHVIKKKYI
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtagtggaggtggaaagcttctacggtgtgtacatgctttactgcaccaacccaaaa
ttcaaaggccgcatctacatcggcttcacagtgaatcctgagcggcggattggacagcac
aacgccgggaggcacaaaggaggcgcaaagagaaccagcggcagagggccgtgggagatg
gttcttattatccacggcttcccctcggatatagctgccctgaggtttgagtgggcgtgg
cagcacccccactcctccagacggctttcccacgtctcccggcgttccaagaaggagagc
agcctgcagttccactggcgcgtcgtctccaacatgctgagggtggcgccatggagcagg
cttcctctgacggcccgctggctcaggcaggagtacaggatggactttgaccccggcctg
cagccccccctgcacatccccatcgccttcggcagcgtgagggccaagaagaagctgccg
tcgccgtctgcaggggaagagctgatgaacacgtgctttctctgcaagaagatggcaacg
gtaagagtcgtgatgaaatcgggaggatggggtataaaacttcttttacatatatggtta
atacaacatgtaataaaaaaaaaatatatatag

DBGET integrated database retrieval system