KEGG   Cyprinodon variegatus (sheepshead minnow): 107104477
Entry
107104477         CDS       T06110                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04141  Protein processing in endoplasmic reticulum
cvg04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107104477 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107104477 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107104477 (atf6b)
Transcription factors [BR:cvg03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107104477 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU HAUS6_N DUF4140
Other DBs
NCBI-GeneID: 107104477
NCBI-ProteinID: XP_015259960
Ensembl: ENSCVAG00000008900
UniProt: A0A3Q2DY03
LinkDB
Position
Unknown
AA seq 717 aa
MTADLLSDLDSRFFADNLLTSEDWDACLFKCESMEEGEDGDFGQGLNYEPSFDNDLVLTL
DPDNRTSPWRYLDDNLLTGNTTVMKNEMALTEPLPVEMLFQVKAEPPSPASSLESECSTL
SPDPKVTIKAENPPTPPYMYGDVLSPPLGTMEVTVATTAVPPSQSQVPTVTQTQLQTPLT
SVPAVITGIQTQTAVLPNTATIKASTILSTKPPIQPRPLCVATLPVPQNPPPAKTLILQG
LPSMDQTRPVVLSPSVCLSSTPAIVKMEPVSPSIPQHCSSPTASSTSKPIVPATTPLPSN
NPNDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRE
RLAVKENGDSASNKRAVCVMVVLLFMTFSFGPVSITDRKLSTGLQEDLVSYTGRRLLEIE
QQQQQQQAAVAQPLTKDEDKLEKQESEGDEQWKRGEAERYAPDSYQFRNLSDMFSDMKDL
VLPDIERYFTSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKTVKKAKITQKAQ
LRKANISRYLPIQAHRSIESQLRVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPA
ISHNKTTRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIIPIKSSAVPPSLRD
PTPPPPSSPHGPHHHHGNNTSLRGRHQHHPSSSPSPRQPLPARTQTPEYLISQSEGV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgactgcggaccttttatctgacctggatagtcgattcttcgccgataatctcttaacg
agcgaagattgggatgcctgtctgttcaagtgcgagagcatggaggaaggagaggacgga
gacttcggtcaggggctgaattatgaaccttcgtttgacaatgaccttgtgctcaccctc
gatcccgacaaccgcacgtcaccatggcgataccttgacgacaaccttctcacaggaaat
accacagtgatgaaaaatgagatggcactaaccgagcctctacctgtggaaatgttgttc
caggtcaaggctgagcctccctctcctgcttcctcgctggagtctgagtgttcgaccttg
tcacccgatccaaaggttacaattaaagctgaaaaccctcctactcctccctacatgtac
ggagatgttctatctccaccgcttgggacaatggaggtaaccgtggcaacgacagcagta
cccccgtcgcagtcccaggtgcccacagttacacagacacagctgcagacaccgttaaca
tccgtcccagcagtcatcactggaatccagacacagactgcagtcctgccaaacactgca
acaataaaagccagcaccatccttagcaccaaacctcccatccagcccagacctctgtgt
gtcgccacgcttcccgtcccccagaaccccccaccagcaaagaccctcatactgcagggg
ctcccttccatggatcagacccgacctgtcgtcctctctccgtctgtctgcctgagttcg
actccggccatcgtcaaaatggagcccgtgtctccgagcatcccccagcactgctcgagt
ccgactgcctcctcaaccagcaaacccattgtcccggcaacaacaccgttacccagcaac
aaccccaacgatattgatatgaaggtgctaaagcggcagcagaggatgatcaagaacagg
gagtctgcctgccagtcgagaaagaaaaagaaggaatatctgcagaacttggaggctcag
ctgagggaggcccagcaggagaacgaacgactccgcagggagaaccaggctctgagggag
aggctggcagtaaaggagaatggcgactctgcaagcaacaagcgagctgtgtgtgtcatg
gtggttctgctgttcatgaccttcagctttggccctgtcagcatcacagacaggaagctg
tcgacgggtctgcaggaagatctggtgtcatatacgggccgccggctgctggagatcgag
cagcagcagcagcagcagcaggcggctgtagctcagcctctcacaaaggatgaggacaag
ttggagaaacaagagtctgaaggagacgagcagtggaagagaggagaggcagagcgatac
gctccagattcttatcaattccgaaacctgagtgacatgttcagtgacatgaaggacctg
gtcctgcctgacatagagcgatacttcacttcttcagactgcagacagttcaaccgctcc
gagtctctcaggcttgcagatgagctgagaggttgggttcatcggcatcagatcgaccgg
aagaagtctggaggaaaaccaaagacagtgaaaaaagcaaagatcactcagaaagctcag
ctaagaaaggcaaacatctccagatatctgccaatccaggctcaccgctctatagaaagt
cagctgagggttcttcccggtccagaggttacttacagcgacttcctggacgccatcgac
cgcagagaggacaccttttacgttgtgtctttcaggagggaccacctgttacttcctgcc
atcagccacaacaaaaccacccggcctaaaatgtctctggtgatgccggccatgtccgtt
aacgagagtctctacaactcgtctcagggctacgagatgatgatgcaggtggactgcgaa
gtcatggacacgcgcatcatccctatcaagtcctccgccgtccctccatctctccgtgac
cccaccccgccacctccctcctccccgcatggcccccaccatcaccatggcaacaacacc
tcactcagagggcgccaccagcaccacccgtcctcttccccctctcccaggcagcctcta
cccgcccgaacacaaaccccagaatacttgatcagccaatcagaaggagtctga

DBGET integrated database retrieval system