KEGG   Chromobacterium violaceum: CV_1062Help
Entry
CV_1062           CDS       T00147                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00020  Citrate cycle (TCA cycle)
cvi00270  Cysteine and methionine metabolism
cvi00620  Pyruvate metabolism
cvi00630  Glyoxylate and dicarboxylate metabolism
cvi00680  Methane metabolism
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
Module
cvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cvi_M00012  Glyoxylate cycle
cvi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1062 (mdh)
   00620 Pyruvate metabolism
    CV_1062 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    CV_1062 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    CV_1062 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CV_1062 (mdh)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CV_1062 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C DAP10
Motif
Other DBs
NCBI-ProteinID: AAQ58737
LNCC_Brazil: CV1062
UniProt: Q7NZ60
LinkDB All DBs
Position
complement(1109731..1110711)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILHLLDLPQAQTALKGVMMELEDC
AFPLLAGMVATDDPNVAFKDVKVALLVGARPRSKGMERKDLLEANGAIFTVQGKALNDHA
ARDVKVLVVGNPANTNAWIAMKSAPDLDPKNFTAMLRLDHNRALSQIAAKTGKPVASIEK
LAVWGNHSPTMYADYRFATIDGQSVKAMINDDVWNRDVFLPTVGKRGAAIIEARGLSSAA
SAANAAIDHIRDWVLGTNGKWVTMGVPSDGSYGIPEGVMYGVPVVCENGEYKRVEGLEID
AFSRERMDLTLAELEEERAAIAHLFG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccccgttcgcgttgccgttaccggcgctgccggccagatcggctacagcctg
ctgttccgcattgccagtggtgaaatgctgggcaaagatcaacccgtcattcttcatctg
ctggacctgccgcaggctcaaaccgcgctgaagggcgtgatgatggagctggaagactgt
gccttcccgctgctggccggcatggtcgccaccgacgacccgaacgtggcattcaaggat
gtgaaggtcgccctgctggtcggcgcccgcccgcgcagcaagggcatggagcgcaaggac
ctgctggaagccaacggcgccatcttcaccgttcagggcaaggctctgaacgaccacgcc
gcccgcgacgtcaaggtgctggtggtgggcaacccggccaacaccaacgcctggatcgcg
atgaagtccgctccggacctggatccgaaaaacttcaccgccatgttgcgtcttgaccac
aaccgcgcgctgtcgcaaatcgccgccaagaccggcaagccggtggcctccatcgagaag
ctggccgtgtggggcaaccactcgccgaccatgtacgccgactaccgcttcgccaccatc
gacggccagtcggtgaaggccatgatcaacgacgacgtgtggaaccgcgacgtgttcctg
cccaccgtgggcaagcgcggcgccgccatcatcgaagcgcgcggcctgtcctccgccgcc
tccgccgccaacgccgccatcgaccacatccgcgactgggtgctgggcaccaatggcaag
tgggtgaccatgggcgtgccctccgacggttcctacggcatcccggaaggcgtgatgtac
ggcgtaccggttgtatgcgaaaatggcgaatacaaacgtgtagaaggcctggagatcgac
gcgttcagccgcgagcggatggacctgaccctggccgagctggaagaagagcgcgcagcc
atcgcccacctgtttggctga

DBGET integrated database retrieval system