KEGG   Chromobacterium violaceum: CV_1067Help
Entry
CV_1067           CDS       T00147                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00020  Citrate cycle (TCA cycle)
cvi00190  Oxidative phosphorylation
cvi00650  Butanoate metabolism
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
Module
cvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cvi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1067 (sdhA)
   00650 Butanoate metabolism
    CV_1067 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CV_1067 (sdhA)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CV_1067 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CV_1067 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 FAD_binding_3 GIDA HI0933_like Thi4 NAD_binding_7 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AAQ58742
LNCC_Brazil: CV1067
UniProt: Q7NZ55
LinkDB All DBs
Position
1112577..1114352
Genome map
AA seq 591 aa AA seqDB search
MGVAVRHFDAVVVGAGGAGMRAALQLSEAGLKTAVLSKVFPTRSHTVAAQGGVSASLGNS
EPDNWHWHMYDTVKGSDWLGDQDAIEFMCREAPKVVVELEHFGMPFDRNPDGTIYQRPFG
GHMSEFGEGKPVRRACAAADRTGHAMLHALYQRNVRANTHFFVEWMALDLIRDAEGRVQG
VVAMEMETSEIVVFQAKATLFATGGAGRIFASSTNAFINTGDGLGMAARAGIPLEDMEFW
QFHPTGVAGAGVLITEGVRGEGGILRNSSGERFMERYAPNAKDLASRDVVSRAMVSEINE
GRGCGPNKDHVLLDITHLDPEVIMSKLPGIREISIKFAGVDPIKAPIPVVPTCHYQMGGI
PTNYHGEVVVHGAPVHGFYAAGEVACASVHGANRLGTNSLLDLLVFGKSSANSMIEFIKQ
QPEDLPPLAMADVERSVARVARLDNQTNGVQVHDARAEMQRVMQTHCGVFRFKDMLAEGV
EKILEVADMVAKTEIGDKSKVFNTARIEALELENLIEVAKATMVSANARTESRGAHVRDD
APDTPDTPNGRDDANWLKHTLWFRDGNRLEYKPVNMKPLTVDTIKLKARSY
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtagctgttcgtcattttgatgcggtagtcgtgggcgccggcggtgccggcatg
cgcgccgcgctgcaactgtcggaagctggtctgaagaccgccgtgctgtccaaggtgttc
ccgacccgttcccacaccgtggccgcccagggcggcgtgtccgcctcgctcggcaactcc
gagccggacaactggcactggcacatgtacgacaccgtcaaggggtcggactggctgggc
gaccaggacgccatcgaattcatgtgccgcgaggcgccgaaggtggtggtggagcttgag
catttcggcatgccgttcgaccgcaacccggacggcaccatctaccagcgtccgttcggc
ggccacatgtccgaattcggcgaaggcaagccggtccgccgcgcctgcgccgccgccgac
cgcaccggccacgcgatgctgcacgcgctgtaccagcgcaatgtgcgcgccaacacccac
ttcttcgtggagtggatggcgctggacctgatccgcgacgccgaaggccgcgtgcagggc
gtggtggcgatggaaatggaaacctcggaaatcgtcgtgttccaggccaaggccaccctg
ttcgccaccggcggcgccggccgcatcttcgcctcgtccaccaatgccttcatcaatacc
ggcgacggcctgggcatggccgcccgcgccggcatcccgctggaagacatggagttctgg
cagttccacccgaccggcgtggccggcgcgggcgtgctgatcaccgaaggcgtgcgcggc
gaaggcggcattctgcgcaacagctccggcgagcgcttcatggagcgctacgcgccgaac
gccaaggacctggcctcccgcgacgtggtatcgcgcgcgatggtgtccgagatcaacgaa
ggccgcggctgcggcccgaacaaggaccacgtgctgctggacatcacccacctcgacccc
gaggtgatcatgtccaagctgccgggcatccgcgagatctcgatcaagttcgccggcgtg
gacccgatcaaggctccgatcccggtggtgccgacctgccactaccagatgggcggcatc
cccaccaactaccacggtgaagtggtggtgcacggggcgccggtgcacggcttctacgcc
gccggcgaagtggcctgcgcgtcggtgcacggcgccaaccgcctgggcaccaactcgctg
ctggacctgctggtcttcggcaagagctcggccaactcgatgatcgagttcatcaagcag
cagccggaagacctgccgccgctggcgatggccgacgtagagcgttcggtcgcccgcgtc
gcgcgtctggacaatcagaccaatggcgtgcaggtgcacgacgcccgcgccgagatgcag
cgcgtgatgcagacccactgcggcgtgttccgcttcaaggacatgctggccgagggcgtg
gagaagatcctggaagtggcggacatggtcgccaagaccgagatcggcgacaagtccaag
gtgttcaacaccgcgcgcatcgaggcgctggagctggagaacctgatcgaagtggccaag
gccaccatggtttcggccaatgcccgcaccgagagccgcggcgcccacgtgcgcgacgac
gcgccggacaccccggacaccccgaacggccgcgacgacgcgaactggctgaagcacacg
ctgtggttccgcgacggcaaccgtctggagtacaagccggtgaacatgaagccgctgacc
gttgacacgatcaagttgaaggcccgctcctactaa

DBGET integrated database retrieval system