KEGG   Chromobacterium violaceum: CV_1068Help
Entry
CV_1068           CDS       T00147                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00020  Citrate cycle (TCA cycle)
cvi00190  Oxidative phosphorylation
cvi00650  Butanoate metabolism
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
Module
cvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cvi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1068 (sdhB)
   00650 Butanoate metabolism
    CV_1068 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CV_1068 (sdhB)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CV_1068 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CV_1068 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AAQ58743
LNCC_Brazil: CV1068
UniProt: Q7NZ54
LinkDB All DBs
Position
1114367..1115077
Genome map
AA seq 236 aa AA seqDB search
MTTENVKFRIYRYDPDKDAKPYMQDISVDMDATEHKLLDALVKLKTKDDTLSFRRSCREG
VCGSDAMNINGKNGLACLTDFRTLKQPIELRPLPGLPVVRDLIVDMAQFFKQYHSIKPYV
INDTPPPERERRQSPEDRKELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFI
ADTRDEATNERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKDLMVKRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaaaacgtcaaattccgcatctaccgctacgacccggacaaggatgccaag
ccgtacatgcaggacatcagcgtcgacatggacgccaccgagcacaagctgctggacgcg
ctggtcaagctgaagaccaaggacgacacgctgtccttccgccgctcctgtcgcgaaggc
gtctgcggctccgacgcgatgaacatcaacggcaagaacggcctggcctgcctgaccgac
ttccgcacgctgaaacagccgatcgagctgcgtccgctgccgggcctgccggtggtgcgc
gacctgatcgtggacatggcgcagttcttcaagcagtaccactcgatcaagccgtacgtg
atcaacgacacgccgccgccggaacgcgagcgccgccagtcgccggaagaccgcaaggag
ctggacggcctgtacgagtgcatcctgtgcgcgtgctgctcgacgtcctgcccgtcgttc
tggtggaacccggacaagttcgtcggcccggccggcctgctggccgcctaccgtttcatc
gcggacacccgcgacgaggcgaccaacgagcgtctggacaacctggaagacccgtaccgg
ctgttccgctgccacaccatcatgaactgcgtcgacgtgtgcccgaagggtctgaacccg
accaaggccatcggcaagatcaaggacctgatggtcaagcgtgcggtatga

DBGET integrated database retrieval system