KEGG   Chromobacterium violaceum: CV_1164Help
Entry
CV_1164           CDS       T00147                                 

Gene name
gst1
Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CV_1164 (gst1)
Enzymes [BR:cvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CV_1164 (gst1)
Transporters [BR:cvi02000]
 Other Transporters
  Pores ion channels [TC:1]
   CV_1164 (gst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AAQ58839
LNCC_Brazil: CV1164
UniProt: Q7NYV8
LinkDB All DBs
Position
complement(1223862..1224482)
Genome map
AA seq 206 aa AA seqDB search
MSKELVFYTNPQSRGNIVHWMLEEVGAPYRPVLLEYGASMKAPEYLAINPMGKVPAIRHG
DQVVTEGAAICAYLADAFPEAGLAPAPAERGDYYRWLFFAASCVEHAWTNQAAGFTPTQE
QQRMFGYGSYEATMNALAKAVAGRRYIAGNRFSAADVYVGRTIGYGIDFGNMRDWPELVA
YWDGLKDRPALLRAAEQAARWQAGKA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagagctcgtcttctataccaacccgcagtcgcggggcaatatcgtgcactgg
atgctagaagaagtgggcgcgccctaccgcccggtgctgctggaatacggcgcgtcgatg
aaggcgccggagtatctggccatcaatccgatgggcaaggtgccggccatccggcacggc
gaccaggtggtcacagaaggcgcggccatctgcgcctatctggccgacgcttttcccgaa
gccggcctcgcgccggcgcccgccgagcgcggcgattattatcgctggctgtttttcgcc
gccagctgcgtggaacacgcttggaccaaccaggccgccggcttcacgcccacccaggag
cagcagcgcatgttcggctacggttcctacgaggcgacgatgaatgcgctggccaaggcg
gtggccggccgccgctatatcgccggaaaccgcttcagcgcggccgacgtctatgtcggc
cgcacgataggctacggcatcgatttcggcaatatgcgcgactggccggaactggttgcc
tactgggacggcctgaaagaccggccggccctgctgcgcgccgccgagcaggcggcccgg
tggcaggccggcaaggcttaa

DBGET integrated database retrieval system