KEGG   Chromobacterium violaceum: CV_1855Help
Entry
CV_1855           CDS       T00147                                 

Definition
(GenBank) probable iron uptake ABC transporter periplasmic solute-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
cvi  Chromobacterium violaceum
Pathway
cvi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CV_1855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cvi02000]
    CV_1855
Transporters [BR:cvi02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    CV_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AAQ59529
LNCC_Brazil: CV1855
UniProt: Q7NWX4
LinkDB All DBs
Position
2010932..2011954
Genome map
AA seq 340 aa AA seqDB search
MKKQMAVAAALAVSGLLSPLAQAKTTLTVYTALEADQVKDYKEAFEKANPDIDIRWVRES
TGVITARLLSEKNHPQADAVWGLAATSLMILDQQGMLQAYAPKGVEKLSPQFVDKARPPK
WTGMDVWAAAICFNTVEAAKKNLPKPESWADLTKPVYKGQIVMPHPASSGTGYLDVSAWL
QTLGEKKGWDYMDKLHANMAQYVHSGSKPCKMAAAGEYPIGISFEYRGAQLKEKGAPIDL
IYPKEGLGWDLEATAIIKGTKNLEAARKLADFSVSLPAMKLYEQNYAVLAMPGVAKQNPY
IPVDYSQRLSKNNFGWAAKNRDAILKEWSRRYESKAAPKE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagatggctgtcgcggccgccctggccgtgtccgggctgctgtccccgctg
gcgcaagccaagaccacgctgaccgtctacaccgcgctggaggcggatcaggtgaaggat
tacaaggaagcgttcgagaaggccaatccggacatcgacatccgctgggtgcgtgaatcc
accggcgtgatcaccgcgcggctgctgtcggagaaaaaccatccccaggccgacgccgtg
tggggcctggccgccaccagcctgatgatcctggaccagcaaggcatgctgcaggcctat
gcgcccaagggcgtggagaagctgagcccgcagttcgtcgacaaggccaggccgccgaaa
tggaccggcatggacgtatgggccgccgccatctgtttcaacaccgtggaagcggcgaaa
aagaatctgcccaagccggagagctgggccgacctgaccaagccggtctacaagggccag
atcgtgatgccgcacccggcttcgtccggcaccggctacctggatgtatccgcctggctg
cagaccctgggcgagaagaagggctgggactacatggacaagctgcacgccaatatggcg
cagtacgtccattccggctccaaaccgtgcaagatggccgccgccggcgagtatccgatc
ggcatctcgtttgaataccgcggcgcgcagttgaaggagaagggcgcgccgatcgacctg
atctatccgaaggaaggcctgggctgggatctggaggccaccgccatcatcaagggcacc
aagaacctggaagccgccaggaagctggccgacttctcggtgagcctgccggcgatgaag
ctgtacgagcagaactacgcggtgctggcgatgccgggcgtggccaaacagaacccctat
atcccggtcgactactcgcagcggctgtccaagaacaacttcggctgggccgccaagaac
cgcgacgccatcctgaaggaatggtcgcgccgctatgaaagcaaggccgcgccgaaagag
tga

DBGET integrated database retrieval system