KEGG   Chromobacterium violaceum: CV_2051Help
Entry
CV_2051           CDS       T00147                                 

Definition
(GenBank) probable zinc-containing alcohol dehydrogenase
Organism
cvi  Chromobacterium violaceum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AAQ59723
LNCC_Brazil: CV2051
UniProt: Q7NWD9
LinkDB All DBs
Position
2238036..2239112
Genome map
AA seq 358 aa AA seqDB search
MSSMKATVFVGPGRIELREKPIPAVGPGDALVKITTTTICGTDVHILKGEYPVASGLTIG
HEPVGVIEKLGADVKGYREGQRVIAGAICPSFTSYGCQDGHPAQDGGCECHGYKPMGGWR
FGNTIDGTQAEYVLVPDAQANLAPIPDGLSDEQVLMCPDIMSTGFAGAEAANIRIGDVVV
VFAQGPIGLCAVAGARLRGASCIIAVDGLDERLGISRRLGADVTLNFKQVDVIAEIMKLT
GGRGVDASIEALGTQGTFESALRVLKPGGTLSSLGVYSSDLRIPLDAFNAGLGDKRIVSS
LCPGGKERMRRLMNVLESDRLDLSPLVTHRYKLDQIVEAYDLFSHQRDGVLKVAIQPF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatgaaagcaacggtattcgtcggacccggcaggatagagctgagggagaag
ccgattccggcagtcggccccggcgacgcgctggtgaaaatcaccaccaccaccatctgc
ggcaccgacgtgcacattctcaagggcgagtatccggtggcgtccggcctgacgataggg
cacgagccggtgggcgtgatcgagaaattgggcgcggacgtcaagggctaccgcgagggg
cagcgggtgatcgccggcgcgatctgtcccagcttcacttcttacggctgccaggacggc
catccggcgcaggacggcggctgcgaatgccacggctacaagccgatgggcggctggcgt
ttcggcaacaccatagacggcacccaagccgagtacgtgctggtgccggacgcccaggcg
aacctggcgccgatccccgacgggctgagcgacgagcaggtgctgatgtgtccggacatc
atgtccaccggcttcgccggcgcggaggcggccaatatcaggataggcgacgtggtggtg
gtgttcgcccaggggccgatcggcctgtgcgcggtggccggcgccaggctgcgcggcgct
tcgtgcatcatcgcggtggacgggctggacgaacgcttgggcatttcccgccggctgggc
gccgacgtcacgctcaatttcaaacaagtggacgtgatcgccgagatcatgaagctgacc
ggcgggcgcggcgtcgacgcctccatcgaggcgttgggcacccaggggacgttcgagtcg
gcgctcagggtgttgaagccgggcggcacgctgtccagcctgggcgtgtactcgagcgat
ctgaggattccgctggacgcgttcaacgccgggctcggcgacaagcgcatcgtgtcctcg
ctgtgcccgggcggcaaggagaggatgcggcggctgatgaacgtgctggagagcgacagg
ctggacctgtcgccgctggtcacgcatcgctacaagctggaccagatcgtcgaggcttac
gacctgttctcgcatcagcgcgacggcgtgctgaaggtggcgatccagcctttctag

DBGET integrated database retrieval system