KEGG   Chromobacterium violaceum: CV_2207Help
Entry
CV_2207           CDS       T00147                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristol acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00061  Fatty acid biosynthesis
cvi00780  Biotin metabolism
cvi01100  Metabolic pathways
cvi01212  Fatty acid metabolism
Module
cvi_M00083  Fatty acid biosynthesis, elongation
cvi_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CV_2207 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CV_2207 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cvi01004]
    CV_2207 (fabZ)
Enzymes [BR:cvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CV_2207 (fabZ)
Lipid biosynthesis proteins [BR:cvi01004]
 Fatty acid synthase
  Component type
   CV_2207 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AAQ59880
LNCC_Brazil: CV2207
UniProt: Q7NVY3
LinkDB All DBs
Position
2378583..2379035
Genome map
AA seq 150 aa AA seqDB search
MSEHAVSIDVREIMRCLPHRYPFLLVDRVTEMEPNVRIKALKNVTINEPFFVGHFEQYPV
MPGVLIIEALAQAAGILAIKSQGERLENELYFFVGIDNARFKRQVVPGDQLVFEVTQMTV
KRGIGKYAARALVDGQVACEAEIMCARREV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacacgctgtctcgatcgatgtccgcgagatcatgcgctgcctgccgcatcgt
tacccgttcctgctggttgaccgcgtcaccgaaatggagcccaacgtgcgcatcaaggcg
ctgaagaacgtcaccatcaacgagccgttcttcgtcggccacttcgaacaatatccggtg
atgccgggcgtgctgatcatcgaggcgctggcccaggccgccggcatcctggcgatcaag
agccagggcgaacgcttggagaacgagctgtacttcttcgtcggcatcgacaacgcccgc
ttcaagcgccaggtggtgccgggcgaccaactggtgttcgaagtgacgcagatgaccgtc
aagcgcggcatcggcaagtacgccgcgcgcgcgctggtggacggccaggtggcttgcgaa
gccgagatcatgtgcgcgcgccgcgaggtgtga

DBGET integrated database retrieval system