KEGG   Chromobacterium violaceum: CV_2504Help
Entry
CV_2504           CDS       T00147                                 

Gene name
sodB1
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CV_2504 (sodB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAQ60175
LNCC_Brazil: CV2504
UniProt: Q7NV42
LinkDB All DBs
Position
2696450..2697028
Genome map
AA seq 192 aa AA seqDB search
MEHKLPELPYALDALAPHISKETLEFHYGKHHQTYITNLNNLIKGTEFENASLEEIVKKS
SGGIFNNAAQVWNHTFYWFGLAPNAGGQPTGALADAINAKWGSFDEFKKAFTQTAIGTFG
SGWAWLVKNSDGSLDLVSTSNAATPLTTDKKPLLTCDVWEHAYYIDYRNSRPNYLEHFWA
LVNWDFVAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaactgcctgaactgccgtacgcgctggacgctctggcgccgcacatctcc
aaggaaaccctggaattccactacggcaagcatcatcagacctacatcaccaacctgaac
aacctgatcaagggcaccgagttcgagaacgcctccctggaagaaatcgtcaagaaatcc
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggttcggc
ctggccccgaacgccggcggccaaccgaccggcgcgctggccgacgccatcaacgccaag
tggggttcgttcgacgaattcaagaaagccttcacccagaccgccatcggcaccttcggc
tccggctgggcctggctggtgaagaacagcgacggcagcctggacctggtatccaccagc
aacgccgccaccccgctgaccaccgacaagaagccgctgctgacctgtgacgtgtgggaa
cacgcgtattatatcgactaccgcaacagccgcccgaactatctggaacacttctgggcg
ctggtgaactgggacttcgtggccaagaacttcgcctga

DBGET integrated database retrieval system