KEGG   Chromobacterium violaceum: CV_2745Help
Entry
CV_2745           CDS       T00147                                 

Definition
(GenBank) probable glutathione S-transferase family protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CV_2745
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CV_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AAQ60414
LNCC_Brazil: CV2745
UniProt: Q7NUF4
LinkDB All DBs
Position
complement(2981124..2981828)
Genome map
AA seq 234 aa AA seqDB search
MADLSAFPITGKWPAQHPDRLQLYSLPTPNGVKVSIMLEETGLPYEAHLVSFESNDQLSP
AFLSLNPNNKIPAILDPNGPDGKPLALFESGAILIYLADKTGQLLPKSPAARYEAIQWLM
FQMGGVGPMFGQLGFFHKFAGKDYEDKRPRDRYVAESRRLLQVLEGRMAGRAWIMGDEYT
IADIAIWPWVRNLVGFYGAGELVGFDDFPNIQRVVQAFAERPAVARGLAIPARD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcagacctgtccgcctttcccattaccggcaagtggccggcccaacaccccgaccgc
ctgcagctttactcgctgccgacgcccaatggcgtcaaggtttccatcatgctggaggaa
accggcttgccctacgaggcgcacttggtcagtttcgagagcaacgaccagctgtcgccg
gcattcctgtcgctgaacccgaacaataaaatcccggccatcctcgatccgaacggcccg
gacggcaagccgctggcgctgttcgagtccggcgccatcctgatctacctggccgacaag
accggccagttgctgcccaagagcccggccgcgcgctacgaggccatccagtggctgatg
ttccagatgggcggcgtggggccgatgttcggccagcttggcttcttccataagttcgcc
ggcaaggactacgaggacaagcgcccgcgcgaccgttatgtcgcagaatcgcgccgcttg
ctgcaggtgctggagggacggatggccggccgcgcctggatcatgggcgacgagtacacc
atcgccgacatcgccatctggccgtgggtacgcaacctggtcggtttctacggcgccgga
gaactggtgggcttcgatgactttcccaacatccagcgcgttgtgcaggcctttgccgag
cggccggcggtggcgcgcggcctggcgataccggcgcgggactga

DBGET integrated database retrieval system