KEGG   Chromobacterium violaceum: CV_3414Help
Entry
CV_3414           CDS       T00147                                 

Gene name
fabG1
Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00061  Fatty acid biosynthesis
cvi00780  Biotin metabolism
cvi01100  Metabolic pathways
cvi01130  Biosynthesis of antibiotics
cvi01212  Fatty acid metabolism
Module
cvi_M00083  Fatty acid biosynthesis, elongation
cvi_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CV_3414 (fabG1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CV_3414 (fabG1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CV_3414 (fabG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cvi01004]
    CV_3414 (fabG1)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     CV_3414 (fabG1)
Lipid biosynthesis proteins [BR:cvi01004]
 Fatty acid synthase
  Component type
   CV_3414 (fabG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776
Motif
Other DBs
NCBI-ProteinID: AAQ61078
LNCC_Brazil: CV3414
UniProt: Q7MBE0
LinkDB All DBs
Position
complement(3707556..3708293)
Genome map
AA seq 245 aa AA seqDB search
MSLQGKVALVTGASRGIGAAIADALAAEGAVVIGTATSESGAAAIHERLSATGGAGRVLN
VTEEGAVDALIESVEKDFGAVAILVNNAGITRDGLLMRMKDEDWDAIMDTNLKSVFKTSK
AVMRGMMKARSGRIINIASVVGAMGNAGQANYAAAKAGIIGFTKSMAREVGSRNITVNCV
APGFIDTDMTRALPEAQREALVGQISLGRLGEAKDIADAVVFLASDRAAYITGQTLHVNG
GMLMP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaaggcaaagtggcgctggtgaccggcgcctcgcgcggcataggcgcggcg
atcgccgacgcgctggccgccgagggcgccgtcgtcatcggcaccgccacgtcggaatcc
ggcgcggccgccatccatgagcgcctgtccgccacgggcggcgcgggccgcgtgctgaac
gtcaccgaggagggcgccgtcgacgcgctgatcgaatcggtggagaaggacttcggcgcg
gtcgcgattctggtcaacaacgccggcatcacccgcgacggcttgttgatgcggatgaag
gacgaggactgggacgccatcatggacaccaatctgaaatcggtgttcaagacctccaag
gccgtgatgcgcggcatgatgaaggcccgcagcggccgcatcatcaatatcgcttccgtg
gtcggcgcgatgggcaatgccggccaggccaactacgcggccgccaaggcgggcatcatc
ggcttcaccaagtcgatggcgcgcgaggtcggcagccgcaacatcaccgtcaactgcgtg
gcgccgggcttcatcgacaccgacatgacccgcgcgctgccggaagcgcagcgcgaggcg
ctggtgggccaaatttccctaggccgcctgggcgaagccaaggacatcgccgatgccgtg
gtattcctggcatcggaccgcgcggcttatattacgggccagactttgcacgtgaacggc
ggcatgctgatgccttaa

DBGET integrated database retrieval system