KEGG   Chlorella variabilis: CHLNCDRAFT_136511Help
Entry
CHLNCDRAFT_136511 CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
Organism
cvr  Chlorella variabilis
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL Lactamase_B_2 UBA_4 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 17353131
NCBI-ProteinID: XP_005845908
JGI: ChlNC64A_1_136511
UniProt: E1ZKH7
LinkDB All DBs
Position
Unknown
AA seq 1506 aa AA seqDB search
MASSSAPAPPSHKLIPGCGFLVDGFQTRYAAHPSVKAYFLTHAHSDHYNGLRDDWSRGVI
YCSHVTARLIAHMLGVGRRWLHPLPLDSPTMIQGVEVTLVSANHCPGAVQFLFRLPDGRR
FIHTGDMRFSPALLANPHLQQFRRVGCDALFLDTTYCNPRYCFPPQEESIEYVASTIQRL
LQEDAEQQQQESQGEGREPGARQRRPFRRLYLISTYGIGKERILTAVHDRCGVRLHVADR
KHAVMQQLDLPGYDPSQLFTTDRGSTPVHVVQWGFLGETWPYFRPNFVSQEALRQELGAE
EVVGFVPTGWLYEMRKETFAVKRKGACSVHLVPYSEHNSFDELREYVRFLRPLQVVPTVG
VEGEDGDKARDRMLKHFRLLVDETASKAKFLQAFHRSSANGATAAGTVDTAVPEQAPQHD
CPDGEQEVWEEEEQAAQQEEVIDLVEEEDEEIETDGSGGGIGSGTGAVQAGESPQALAGL
AAAGDDPAAAAAAVPAIASPAAAPVASPPAEEGGEGPSDPLLHQLLSVLGEEVSKQQGRQ
LLVAAGGDLQGAVNGYYDGLATAAAAGSGRGKDAATVASPAPSTAADSSRGGGGGAGGGI
KRPAPTPATKPKGKKQKGRAAVAASPGQRNITSFFTKQQGPPQGQRQQQEPQEQQQDSGG
AAAVAAADAAAGGDLLADDEDLALTLNVPLAASPSAAAAAAAAAGQAAAGVSEVEPDALA
APSGKPKLVLPPPPSPGSAAAASAKGAAGGSFFLSGRGAGGQTGSGGGGSREAAVPRDAL
ALPLERYDPVAHACWEPGEPLLREPTPYLHLARAFEAMHSTTKRLRISGRPAADVLVNCF
RSVLALRPAEELVQTAYLATGRIAPDYEDGTELRVGGSIMTAAIVEATGVSKARLHDMYK
DMGDAGDVFQALRHNQAVLQRPAPLTVPGVFAALQQIAQEKGEGSQKRRQRLVLSLLRAC
REQEPRFVARTLVQNLRVGANWRSVVPALAKAVVLHKEGGRVAKARLDQAAAAATTAFHV
CPDLRLLCDAMLAHPTEEWEQRCLLTPGEGPPLSRHRMPVKPMLAKICEGLEDAVQQMKD
APFLAEFKYDGMRAQIHVIEGGQVRIFSRSCEDQTPRWPDAVQQILEAMQGRLRAFQELA
SRKKAAELAEVSVHVCIFAFDLLHRDGASLMHLPLEQRREQLLLALPNMRPGRCALAQSV
RFPEAGAATSPLAAGSSVQLPGPGDQHEEAGGSADDTRGGTLMEIEGRIGAHGQEAAPLE
ERLQEMLLQAFAAGAEGLMLKKLAAAYEPSKRSDHWIKVKKDYVVGLHDTLDLVVIGAWH
GNGRKAGWFSPYLLACYDPDTEQLQSVCRCMSGFTDAFYRESKERLSQTIIPGHKPYYNT
GEQPDMWFEPREVWEIRGADLSLSPVHKAAEGLVHAERGLGLRFPRFLGRVRQDKSPEDA
TSSQQIAEMYRAQTRKVETAGQRLAADKQLQLPQEQAAGPESYAGSGGEEEEDGADIDAE
EYHHSS
NT seq 4521 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctcgtcggcgccagcgccaccgtcccacaagctcatccctggctgcggcttt
ctggtggatggcttccagacccgctacgctgcccacccctcggtgaaggcctacttcctg
acccacgcccactcagatcactacaacgggcttcgcgacgactggagccgtggcgtcatc
tactgcagccacgtcaccgcccgcctgattgctcacatgctgggcgtcgggcgccggtgg
ctgcacccgctgccgctcgactcgccaaccatgatccaaggggttgaagtgacgctcgtc
agcgccaaccactgccccggcgccgttcagttcctgttccgcttgcccgacggccgccgc
ttcatccacaccggcgacatgcggttcagccccgcgctgctggccaacccccacctgcaa
cagttcaggcgcgtgggctgtgatgccctctttctcgacacaacatactgcaacccgcgc
tactgcttccctccccaggaggagagcatcgagtatgttgccagcactatccagcgcctg
ctgcaggaggacgcagagcagcagcagcaggagtcgcagggcgagggacgggagccaggt
gccaggcagcgccgccccttccgcaggctctacctcatcagcacctacggcataggcaag
gagaggatcctgacggcagtgcacgaccggtgcggcgtgaggctgcacgtggccgaccgc
aagcacgccgtcatgcagcagctggacctgccaggctacgacccctcccagctcttcaca
acggaccgtggcagcacgccggtgcacgtggtgcagtggggcttcctgggagagacctgg
ccgtacttcaggcccaactttgtgagccaggaagcgctgcggcaggagctgggggcggag
gaggtggtggggtttgtgcccacgggctggctgtacgagatgcgtaaggagacgtttgcg
gtgaagcgcaagggcgcctgcagcgtgcacctggtgccctactctgagcacaacagcttc
gacgagctgcgggagtatgtgcgcttcctgcggcccctccaggtggtgcccacggtgggc
gtggagggcgaggatggcgacaaggcgcgggacaggatgctgaagcacttcaggctgctg
gtggatgagacggccagcaaagccaagtttctccaggcttttcaccgctccagcgccaat
ggtgccaccgccgctggcactgttgacacagctgttcctgagcaggcgccgcagcacgac
tgccccgatggggagcaggaggtgtgggaggaggaggagcaggcagcgcagcaggaggag
gtgattgatttggtggaggaggaggatgaagagatagaaactgatggcagcggcggcggc
attggcagcggcactggagcagtacaggcaggcgaaagcccacaggctttagcagggctg
gcagctgcaggagacgaccctgcagcagcagcagcagcagtgccagcgatcgcctcacca
gcagcagcgccagtcgcgtccccgcctgccgaggagggcggggaggggccctcggacccg
ctgctgcaccagctgctgtcggtgctgggtgaggaggtcagcaagcagcagggccgccag
ctgctggtggcagctgggggggacctgcagggggcagtgaatggctactatgatggcctg
gcaacagctgccgctgcggggagcggcaggggcaaagacgcagccacggtggcttcgccg
gcacccagcaccgctgccgatagcagccgcggaggaggaggaggagcaggaggaggcatc
aagcgacctgcacccacgcccgccacaaagcccaagggcaagaagcagaaggggagggca
gcggtggcggccagcccagggcagcgcaacatcacttctttcttcaccaagcagcagggc
ccacctcaggggcagcggcagcagcaggagccgcaggagcagcagcaggacagtggggga
gcagcagcagtagccgcagcagatgctgcggctggtggcgacttgttggcagacgatgag
gacttggccctgactctcaacgttccgctggcagcgtcaccctcagcagcagcagcagca
gcagcagcagcaggacaagcagcagcaggcgtctcagaggtagagccagacgcattggca
gcaccaagcggcaagcccaagctggtcctgccgccgccgccctcccccgggtctgctgca
gcagcgtctgccaaaggcgccgctggaggaagcttcttcctgtctgggcgcggcgccgga
ggccagaccggcagcggcggcggcggctccagggaggcagctgtgccccgggatgcgttg
gccctgccgctggaaagatatgatcctgtggcgcacgcttgctgggagccaggcgagcca
ttgctgcgagagcccaccccgtacctccaccttgcccgcgcctttgaagccatgcactcc
accaccaagcggctgcgcatctcaggcaggcccgcggccgacgtgctggtcaactgcttc
cgctcggtgctggcgctgcgcccggcggaggagctggtgcagacggcgtacctggccacc
ggcaggattgcgccagactatgaggatggcacggagctgagggtgggaggatccatcatg
acggccgccatcgtagaggccacgggcgtgtccaaggcccgcctgcacgacatgtacaag
gacatgggggatgcgggagacgtgttccaggctctgcgccacaaccaggccgtgctgcag
cgccccgcccccctcaccgtgcccggcgtgtttgccgcgctgcagcagattgcgcaggag
aagggggagggctcccagaagcggcggcagcgcctcgtgctgtcgctgctgcgcgcctgc
cgcgagcaggagccgcggtttgtggcgcgcacgctggtgcagaacctgcgggtgggggcc
aactggaggtcggtggtccctgccctggccaaggcggtagtgctgcacaaggagggtggc
agggtggccaaggcccgcctcgaccaggcggccgcggcggccaccaccgccttccacgtc
tgccccgacctgcggctgctgtgcgatgccatgctggcacaccccacagaggagtgggag
cagcggtgcttgctcacgccaggcgagggcccgccgctcagccgccaccgcatgccggtc
aagcccatgctggccaagatttgcgagggactggaggatgctgtgcagcagatgaaggat
gcgcccttcctggccgagttcaagtacgacggcatgcgggcgcagatacacgtcattgag
ggcggccaggtccgcatcttcagccgcagctgcgaggaccagacgccccggtggccagac
gccgtgcagcaaatcctggaggccatgcaaggcaggctgagggcgttccaggagctggcc
agccgcaagaaggctgcagagctggcggaggtgtcagtacacgtctgcatctttgccttt
gacctgctgcaccgcgacggcgccagcctgatgcacctgccgctggagcagcggcgcgag
cagctgctgctggcgctgcccaacatgcgtcccgggcgttgcgccctagcacagtctgtg
cggttccctgaggcgggcgctgcgacatcaccgttggctgcggggagcagcgtgcagctg
cctgggccaggagaccagcacgaggaagcggggggctcagctgatgataccaggggagga
accttgatggagatcgagggccggatcggggcgcatgggcaggaggcagcgccgctggag
gagcgcctgcaggagatgctgctccaggctttcgccgctggcgcagaagggctcatgcta
aaaaaactggctgctgcatacgagcccagcaagcgctccgaccactggatcaaagtgaaa
aaggactacgtagtcggcctgcatgacactttggacctggtggtgattggcgcctggcac
ggcaacggcaggaaggcgggctggttctccccctacctgctggcctgctacgaccccgac
accgagcagctgcagagcgtgtgccgctgcatgagcggcttcaccgatgccttctacagg
gagagcaaggagaggctgtcccagaccatcatcccgggtcacaagccgtactacaacaca
ggcgagcagccggacatgtggtttgagccccgagaagtctgggagatacgcggggccgac
ctatccctgtcaccggtgcacaaggcggcagagggccttgtgcacgccgagcgtggcctg
gggctgcgtttcccgcgcttcctggggcgggtgcggcaggacaagagccccgaggatgcc
acctcgtcccagcagattgcagagatgtaccgcgcgcagacacgcaaggtcgagaccgca
gggcagcgcctggcggctgacaagcagctgcagctgccgcaggagcaagcggcggggcca
gagtcgtatgcaggttctggcggggaagaggaggaggacggagcagacatagatgcagag
gagtatcaccacagctcctag

DBGET integrated database retrieval system