KEGG   Chlorella variabilis: CHLNCDRAFT_141480Help
Entry
CHLNCDRAFT_141480 CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cvr  Chlorella variabilis
Pathway
cvr00052  Galactose metabolism
cvr00500  Starch and sucrose metabolism
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CHLNCDRAFT_141480
   00500 Starch and sucrose metabolism
    CHLNCDRAFT_141480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cvr04147]
    CHLNCDRAFT_141480
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CHLNCDRAFT_141480
Exosome [BR:cvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHLNCDRAFT_141480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil
Motif
Other DBs
NCBI-GeneID: 17350523
NCBI-ProteinID: XP_005843192
JGI: ChlNC64A_1_141480
UniProt: E1ZSY6
LinkDB All DBs
Position
Unknown
AA seq 564 aa AA seqDB search
MSRTLLPAPALALLLAACLTSAAPPLDACDRLGPRVQCGSIAVSQRTCEEQDCCWTVQPL
DTEPWQPDVFLPSCFYPNTGASEYALQEPSVGLAEGDMGNATLTNMTSTQPELGGDFQTA
ALSVEEFTPGKAHHVLRIRIIPLNASAPPRWEVPPEFFAPDSLLAGGDGGGTQPVTAPRQ
FEVDVEDAPFGFTVLRVDRQSGAPLATTFNSSGLRLILKASAGTTCWPLGADQYLELSTH
VDAASYIYGGGERSSETTYMTRNGYPYAGWARDQNPQVPMRNTYSSWPFALVLEQDGTAW
GALLLNSNGMEMAATPDKLTWRAIGGAIDLFVFLGPTPLDVIDQLTAVVGRPVMQPFWAF
GFHQYGYKTVWENFVSRLHANDQHWVPILDPGIKIDEGFDPYLDGLQQNAYILDERGDPY
IGWVWPGGCHFPDFGFNPAVDAYWLAQLDIYNGYAQWDGLWIDMNEIANFCTGNVCHMPT
AEAVANQRGFPPFQCQLLCYDSLTAGLSNADLALTSSVLARHAGDVLEYDAHNLYGLAEA
RVTAAAIRLIKGTRPFILTRATRL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcaccctgcttcctgcgccagcgctggcgctgctgctggccgcgtgcctgacc
tctgctgcccccccgctcgatgcctgcgacaggctaggccccagagtgcagtgcggctcg
atcgccgtctcgcagcgcacctgcgaggagcaggactgctgctggacggtgcagccgctg
gacaccgagccctggcagcccgacgtcttcctgccctcctgcttctaccccaacaccggc
gccagcgagtatgcgctgcaggagccgtctgtcggcctggccgaaggcgacatgggcaat
gccacgctgactaacatgacgagcacgcagcctgagctgggcggcgacttccagacggcg
gcgctgagcgtggaggagttcaccccaggcaaggcacaccacgtgctgcgcatccgcatc
attccactcaacgctagcgcgccaccgcggtgggaggtgccgcccgagttcttcgcccca
gattccctcctggcaggtggcgacggcggcggcacccagccggtcactgcccctcgccag
tttgaggtggacgtggaggatgcgccctttgggttcaccgtgcttcgcgtggaccgccag
agcggggcccccctcgccaccaccttcaactccagcggcctgcgcctcatcctcaaggcg
agcgctggaacgacttgctggccgcttggtgctgatcagtacctggagctgtctacccac
gtggacgccgcctcctacatctatggcggcggcgagcgctcctcggagaccacctacatg
acgcgcaacggctacccctatgctgggtgggcccgggaccaaaacccgcaggtgcccatg
cgcaacacgtactcctcctggccctttgcgctggtgctggagcaagacggcactgcctgg
ggcgccctgctgctcaacagcaacggcatggagatggcggccactcccgacaagctgacc
tggcgagccatcggcggtgccattgatctgtttgtcttcctgggccccaccccactggat
gtcatcgaccagctgacagccgtggtggggcgccccgtcatgcagcctttctgggccttc
ggcttccaccagtatggctacaagacggtttgggagaactttgtgtcgcgcctgcacgcc
aatgaccagcactgggtaccaatccttgatcccggcattaagatcgacgaaggttttgat
ccctacctggacggcctgcagcagaatgcgtatatcctggatgagcgtggagatccctac
atcggctgggtgtggcctggcggctgccacttcccagattttgggttcaatcccgccgta
gacgcttactggctggcccagcttgacatctacaacggctacgctcagtgggacgggttg
tggatcgatatgaatgagattgccaacttctgcacaggcaacgtctgccacatgcccaca
gctgaggcggtggccaaccaacgcggcttcccgccgttccagtgccagctgctgtgctac
gattccctcaccgcggggctcagcaatgccgacctggcgctgacctcgtcagtgctggcg
cgccacgcgggtgacgttctggagtatgatgctcacaatttgtatggtctggccgaggcg
cgtgtcacggctgccgccatccgcctgatcaagggcactcgccccttcatcctcaccagg
gctactcgcttgtga

DBGET integrated database retrieval system