KEGG   Chlorella variabilis: CHLNCDRAFT_142107Help
Entry
CHLNCDRAFT_142107 CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
cvr  Chlorella variabilis
Pathway
cvr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CHLNCDRAFT_142107
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cvr03036]
    CHLNCDRAFT_142107
Enzymes [BR:cvr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CHLNCDRAFT_142107
Chromosome and associated proteins [BR:cvr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CHLNCDRAFT_142107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET LBR_tudor
Motif
Other DBs
NCBI-GeneID: 17357647
NCBI-ProteinID: XP_005850072
JGI: ChlNC64A_1_142107
UniProt: E1Z7S7
LinkDB All DBs
Position
Unknown
AA seq 891 aa AA seqDB search
MAADSLRWTVDTMPPFQEIEGRLVIKDFRDEETKKVRPFKGTVKSFDAKRKWYRVVYEDG
DSEDVWWKDLLPLLQRAAAASPTAAPAAVCAGTGGKQGSRGSSAAAPSPASRSQQLAAPA
AVPDMQQHKEQTAKQQHKAKAAGKQAAAASKKPTAAKEPVGRPPRPRTEEEELAAAKKAK
DKQAGKKALHASSQPKKRSKGKDSEGQGGERKAAGKKRKPAAAAKEGAGGTGEGAPKRRR
KPAGPKIELPVPKLGQEYVYEPGQEPWRSVPGFSWEVKDEPDLSAAAVNRLRNVQRTYNK
YYIQAEVDEKVRVEAVLADQKARGKFGKEPRPANRPDRAAESRMVNVEKLAIRGQRVAGH
YPGWDIGSRAYSRSELCCMGFHRVPIAGIDFVGAGKAGNGAPPFATSVMVSGWYQDDSDN
GAELWYTGEGGNDLLHGRNQVADQSLQRGNAALQGNIMLGIPVRVTRKQKDPHGHYGCCY
LYDGLYDVVAMRHVKGKEQTWVYQFLLRRRKGQGPLLSERVEWGGIAAARAIVPKTRQGV
VDLDISRGKEERPVAAIDDTWLAGGADHEPQGDIPPCTGLDDIADERQLVGKVVRGINAE
RIAELREQGYTPAVQYITQYEFVGRAAAKAGQLAQAVLPLELKTHPQPYLAKLNHAVTQR
ASKYRLEIFKTRNGRGWGVRSLDTIPQFGFVVAYVGEVYDAEEHEHLVRTVEEQDAEYTF
DMAPRPDTNWDGTEKVVPDQAKAEFVACGLRKRNVGAFLNHSCAPNCFVQPVLDTHHDRR
CPKICIFASENIAPMTELTLDYGEAYAAGFQGGCKCGAADCISLRGPQAAAGHQRQAQED
SAGEGDGEDGEEEEEAEEVVVEEEEEVEEVVEEEEEEVEEVMEKKNKEGGV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggactcgcttcgctggacagtcgacaccatgccgccgttccaagagatcgag
ggccggttagtgatcaaggactttagggacgaggagaccaagaaagtgcggcccttcaag
ggaaccgtcaagtcgttcgacgccaagcgcaaatggtaccgtgtagtgtacgaggatggg
gacagcgaggatgtctggtggaaggatctgctgcccctgctgcagcgcgccgccgccgcc
tcccctacagcagccccagcagcagtgtgtgctggcacgggcggcaaacagggcagtcgc
ggctccagcgcagccgctccttcgccggcgtcgcgctcgcagcagctggctgcaccggcg
gcggtgcctgacatgcagcagcacaaagagcagaccgccaagcagcagcacaaggcaaaa
gccgctggcaaacaggctgcggcagcatccaagaagcccacagcagccaaggagccagtg
ggcaggccgcctcggccacggacggaggaggaagagttggcggcggctaagaaggcaaag
gataagcaggccggcaagaaagcgctgcatgcgagctctcagccgaagaagcgcagcaag
gggaaggacagcgaggggcagggtggcgagcgcaaggccgcaggcaagaagcgcaagccg
gcggctgccgccaaggagggcgctggcggcaccggggagggcgccccgaagcggcggagg
aagccggcggggcccaagattgagctgccggtgcccaagctggggcaggagtatgtgtat
gagccaggccaggagccgtggcgcagcgtgccgggctttagctgggaggtgaaggacgag
cccgacctgagcgccgccgccgtcaacaggctgcgcaatgtgcagcgcacatacaacaag
tattacatccaggcggaggtggatgagaaggtgcgcgtggaggccgtgcttgctgaccag
aaggcgcggggcaagtttggcaaggagccgcggcccgccaaccgccccgacagggcggcg
gagtcgcgcatggtgaatgtggagaagctggccatccgcggccagagggtggctgggcac
taccccggctgggacattggcagcagagcgtactcgcggtcagagctgtgctgcatgggc
ttccaccgcgttcccatcgccggcatcgactttgtgggggcgggcaaggcgggcaacggc
gcgccgccgtttgccaccagcgtgatggtcagcggctggtaccaagatgacagcgacaac
ggcgccgagctctggtacaccggcgagggcggcaatgatctgctgcacgggcgcaaccag
gtggccgaccagtcactgcagcgtggcaacgccgccctgcagggcaacatcatgctgggc
atccctgtgcgtgtcactcgcaagcagaaagaccctcacggccactatggctgctgctac
ctgtatgatgggctgtacgatgtggtggccatgcggcacgtcaagggcaaggagcagacg
tgggtgtaccagttcctgctcaggcggcgcaagggccagggcccgctgctgtcagagcgc
gtggagtggggcggcatcgccgccgcgcgcgccatcgtgcccaagactcggcagggagtg
gtggacctggacatctcacgcggcaaggaggagcggcctgtggctgccatcgacgacacc
tggctggcgggcggcgccgaccacgagcctcagggcgacatcccgccctgcacggggctg
gacgatattgcggatgagcgacagctggtgggcaaggtggtgcggggcatcaacgcggag
cgcatcgcggagctgcgggagcagggctacacccccgcggtgcagtacatcacgcagtac
gagtttgtggggcgggcggcggccaaggcggggcagctggcgcaggcggtgctgccgctg
gagctcaagacccacccccaaccctaccttgccaagctcaaccacgcggtgacgcagcgg
gcttccaagtaccggctggaaatcttcaagacgcgcaacggccgaggctggggcgtgcgc
tcccttgacaccatcccccagtttggctttgtcgttgcctacgtgggggaggtgtacgat
gctgaggagcacgagcatttggtgcgcactgtggaggagcaggatgctgagtacaccttt
gacatggcgccccgcccagacacaaactgggacgggacggagaaggtggtgccagaccag
gccaaggcggagtttgtggcgtgcgggctgcgcaagcgcaacgtgggcgccttcctcaac
cacagctgcgctcccaactgcttcgtgcagccggtgctggacacccaccacgaccgccgc
tgccccaagatctgcatctttgccagcgagaacattgcgccgatgacggagctgacgctg
gactatggcgaggcctacgccgccggcttccagggcggctgcaagtgcggcgccgcagac
tgcatctcgctgcggggcccgcaggccgcggctggccaccagaggcaggcgcaggaggac
tcggctggtgagggggatggcgaagatggcgaggaggaggaggaggctgaggaggtggtg
gtggaggaggaggaggaggttgaggaggtggtggaggaggaggaggaggaggttgaggag
gtgatggagaagaaaaacaaagagggaggagtatga

DBGET integrated database retrieval system