Chlorella variabilis: CHLNCDRAFT_27202 Help Entry CHLNCDRAFT_27202  CDS       T02924                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism cvr  Chlorella variabilis Pathway cvr03010   Ribosome cvr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cvr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CHLNCDRAFT_27202   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CHLNCDRAFT_27202  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:cvr03011]     CHLNCDRAFT_27202    04121 Ubiquitin system [BR:cvr04121]     CHLNCDRAFT_27202 Ribosome [BR:cvr03011]  Ribosomal proteins   Eukaryotes    Large subunit     CHLNCDRAFT_27202   Archaea     CHLNCDRAFT_27202 Ubiquitin system [BR:cvr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CHLNCDRAFT_27202 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD TBK1_ULD Motif Other DBs NCBI-GeneID:  17351588 NCBI-ProteinID:  XP_005844299 JGI:  ChlNC64A_1_27202 UniProt:  E1ZPS3 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MQTGKTHTVYAHPSWTVGNLMWTIEKMEGIPIGFQRLLFNRKLLVGQDTLEQHKIGSQST LHLFLQIRGD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcagacgggcaaaactcacacggtgtatgcccacccgtcatggaccgtgggcaatctg atgtggaccatcgagaaaatggagggcatccctattggctttcagcgcctgttattcaac cgcaagctgctggtgggccaggacactttggagcagcacaagatcggaagccagagcaca cttcaccttttcttgcagatcaggggcgactga

DBGET integrated database retrieval system