KEGG   Chlorella variabilis: CHLNCDRAFT_28598
Entry
CHLNCDRAFT_28598  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K22464  fatty acid photodecarboxylase [EC:4.1.1.106]
Organism
cvr  Chlorella variabilis
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHLNCDRAFT_28598
Enzymes [BR:cvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.106  fatty acid photodecarboxylase
     CHLNCDRAFT_28598
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 Lycopene_cycl GDI
Other DBs
NCBI-GeneID: 17350319
NCBI-ProteinID: XP_005842992
JGI: ChlNC64A_1_28598
LinkDB
Structure
PDB: 
5NCC

Position
Unknown
AA seq 593 aa
MWLLLYTGAVRRGGALSARASAVEDIRKVLSDSSSPVAGQKYDYILVGGGTAACVLANRL
SADGSKRVLVLEAGPDNTSRDVKIPAAITRLFRSPLDWNLFSELQEQLAERQIYMARGRL
LGGSSATNATLYHRGAAGDYDAWGVEGWSSEDVLSCASLARRSPAGPGAYHGSGGPMRVE
NPRYTNKQLHTAFFKAAEEVGLTPNSDFNDWSHDHAGYGTFQVMQDKGTRADMYRQYLKP
VLGRRNLQVLTGAAVTKVNIDQAAGKAQALGVEFSTDGPTGGAELAPGGEVIMCAGAVHT
PFLLKHSGVGPSAELKEFGIPVVSNLAGVGQNLQDQPACLTAAPVKEKYDGIAISGERNS
LLGQATIYLLGGRGGLTSTGCDRGAFVRTAGQALPDLQVRFVPGMALDPDGVSTYVRFAN
GITMQLIACRPQSTGSVGLKSADPFAPPKLSPGYLTDKDGADLATLRKGIHWARDVARSS
ALSEYLDGELFPGSGVVSDDQIDEYIRRSIHSSNAITGTCKMGNAGDSSSVVDNQLRVHG
VEGLRVVDASVVPKIPGGQTGAPVVMIAERAAALLTGKATIGASAAAPATVAA
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtggctgctcctgtatacaggcgcggtccgtcgcggaggtgcgctctcggcacgcgcc
tctgcggtggaggacatccgcaaggtgctgtctgacagcagcagcccggtggcggggcag
aagtacgactacattctggtcggcggcggcaccgcggcctgcgtgctggccaatcgcctg
tccgccgacggctccaagcgtgtgctggtgctggaagccggccccgacaacacctcgcgc
gacgtcaagatccccgccgccatcacccgcctcttccgcagccccctcgactggaacctc
ttctccgagctgcaggagcagctggcggagcgccagatctacatggcgcgcggccggctg
ctgggcggcagcagcgccaccaatgccacgctgtaccaccgcggcgcggcgggcgactat
gatgcctggggcgtggagggctggagctcggaggacgtgctcagctgcgcttctctcgcc
cgtcgctcgcctgcaggccctggcgcgtaccacggcagcggcggccctatgcgtgtcgag
aacccacgctacaccaacaagcagctgcacaccgccttcttcaaggccgcagaggaggtg
gggcttaccccaaacagcgatttcaacgactggagccacgatcatgctgggtacggtacc
ttccaggtcatgcaggacaagggcacacgtgccgacatgtaccggcagtacctcaagccc
gtgctgggccgcagaaacctgcaggtgctgaccggcgcggccgtgaccaaggtcaacatt
gaccaggctgcaggcaaggcgcaggctctgggtgtggagttctcaaccgacgggcccaca
ggtggcgctgagctggcgccaggcggcgaggtgatcatgtgtgccggcgccgtgcacacg
cccttcctgctcaagcacagcggcgtggggccctcggcggagctcaaggagtttggcatc
ccggtggtttccaacctggcaggtgtgggtcagaacctgcaggaccagcccgcctgcctg
accgcggcgccggtcaaggaaaagtatgatggcatcgccatcagcggtgagcgaaactcg
cttttgggacaagcgacgatctacctgctgggcggccgcggcggcctcacatccaccgga
tgcgaccgcggcgcctttgtgcgcacggcaggccaggcgctgccagatctgcaggtgcgc
tttgtgccgggcatggcgctggacccggatggcgtgtccacgtatgtgcgctttgccaac
ggcatcaccatgcagctgatcgcctgccgcccgcaaagcacgggcagcgtgggcctcaag
agtgccgacccctttgcgccgcccaagctgagccccggctatctgacggacaaggacggc
gctgacctggccacgctccgcaagggcatccactgggcgcgcgacgtggcgcgcagcagc
gcgctcagcgagtacctggatggcgagctgttccccggcagcggagtggtgagcgatgat
cagattgatgagtacatccgccgcagcatccatagctccaacgccatcacaggcacatgc
aagatgggcaatgccggcgacagcagcagcgtggtggacaaccagctgcgggtgcacggt
gtggagggcctgcgggtggtggatgcctcggtggtgcccaagatcccaggtggccagacg
ggcgcgccagtggtgatgattgcggagcgcgccgccgcgctgttgactggcaaggcgacg
atcggggcgagcgctgcggccccggcgacagtggcagcatga

DBGET integrated database retrieval system