KEGG   Chlorella variabilis: CHLNCDRAFT_37051Help
Entry
CHLNCDRAFT_37051  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cvr  Chlorella variabilis
Pathway
cvr00620  Pyruvate metabolism
cvr00710  Carbon fixation in photosynthetic organisms
cvr01100  Metabolic pathways
cvr01200  Carbon metabolism
Module
cvr_M00168  CAM (Crassulacean acid metabolism), dark
cvr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHLNCDRAFT_37051
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHLNCDRAFT_37051
Enzymes [BR:cvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CHLNCDRAFT_37051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 FTA4
Motif
Other DBs
NCBI-GeneID: 17351576
NCBI-ProteinID: XP_005844287
JGI: ChlNC64A_1_37051
UniProt: E1ZPP9
LinkDB All DBs
Position
Unknown
AA seq 955 aa AA seqDB search
MASLTPSGSNKGNLGISSYALEVNQALLEEDDGLLRDQFLSVFRSHHPQLANKVDVIFAL
AQAWCMSESDSDFEMLEKRLEALTPDESILVSSAFSQLLNLHNVTEESITARVEKAARLG
EVEQATRSTNKSLQRLVSTKGLQPEEIYAALCKQTVGLVFTAHPTQATRQSLLKKYGEIR
HAMDRLHNTRLSNYERLECLDEIRSQIQGAWRTDEIRRRKPSPQDESREGLTYFHETIYS
GLPVFLRRIDTALKNIGQPMLPLDARLFSFGAWMGGDRDGNPFVTPDTTRDVVIGARLSA
TTLMTEQVEKLMYELSMWRASPELKARLSRRLQWPANTYDVVFMSINEPFRLVLSDVRAR
LQRTKDLLHHCLEHASVNVREALESDPEAYRDETELLATLRMCYDSLISTGDIHIASSHL
LDVLRQARVFGLFLCKLDIRQESVKHTEAMDAITTYLGLGSYKQWDEPRRMDFLVNELTG
KRPLLPPDLPMTPEVADVIGTFRMLAQLPTDSLGAYIISMSHTASDVLAVVLMQKECGVN
PMLRVVPLFETLDDLHYAETAMRQLFTNPWYLAHINGQQEAMIGYSDSGKDAGRLAAAWG
LYEVQERLTKVADEFDVHMTLFHGRGGTVGRGGGPAHLAVLSQPPGTIRGTIRVTVQGEV
MEQQFGEKESAFHTMDLYTSAVLEATLAPTEQPPQLWREMMADMARVSCEAYRAVVQEDP
RFVSFFQSITPVNELGRMNIGSRPAKRRSHGSIDTLRAIPWIFAWTQVRFHLPVWLGVGE
ALNSMIKAGKLELLQDMFTNWMFFRVTLDMLEMVFAKADPRVVKMYEKALVEPELHGLGD
ELLKKFEMAEQSLLTVMKHSRLLSSSSTAFLQQKLQLRAPYVAPLNILQVSCLKTLRTIE
AGKSVDDLVPDGYKPSEKALALMSRGDSKHPFLAGIEDTMIITMKGIAAGMQNTG
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctcacacccagtggtagcaacaagggaaacctgggaatctccagttatgca
ctggaggtgaaccaggcactgctggaagaggacgatgggttgctgagagatcaatttctc
agcgtgttcagaagccatcacccccagctggccaacaaggtggacgtcatctttgcgctc
gcccaggcctggtgcatgtcagaaagcgacagcgactttgagatgctggagaagcgcctg
gaggcgctcaccccggacgagtccatcttggtgtccagcgccttctcgcagctgctcaac
ctgcacaatgtgaccgaggagtcgatcaccgcacgggtggagaaggcggcacgcctggga
gaggtagagcaggccacgcgatccaccaacaagtcgctgcagcgcctggtcagcacaaag
ggactccagcccgaggagatatatgccgctctgtgcaagcagaccgttggcctggtcttc
accgctcaccctacccaggccactcgccagtcgctgctgaaaaagtacggcgagatccgg
cacgccatggaccgcttgcacaacactcggctgagcaactacgagcggctggagtgcctg
gacgagatccgcagccagatccagggcgcgtggcgcacagacgagatccggcgccgcaaa
ccgtcgccccaggacgaatcacgggaggggctgacctacttccatgagaccatctactct
ggcctccccgtgttcttgcgccgcatcgacaccgctctcaagaacattgggcagccgatg
ctgccgctggatgccaggctcttctcctttggcgcctggatgggtggcgaccgcgacggc
aaccccttcgtcacccctgacaccacccgtgacgtggtcatcggcgctcgcctcagtgcc
accaccctgatgacagagcaggttgagaagctgatgtatgagctgtccatgtggcgcgcc
tcgccagagctcaaggcaaggctgtccagacgcttgcaatggcctgctaacacatatgac
gttgtgttcatgtccatcaacgagcctttccgccttgtgctctctgacgtccgcgcccga
ctgcagcgcaccaaggatttgctgcaccactgcctggagcatgccagcgtgaatgtgaga
gaggcactggagtctgaccctgaggcataccgcgatgagaccgagctgctggctacgctg
cgcatgtgctacgactccctaatctccaccggtgacatccacattgcatcctcccacttg
ttggacgtgctgcgtcaggcccgcgtctttggacttttcctgtgcaagttggacatccgg
caggagagtgtgaagcacaccgaggccatggatgccattaccacctatctggggctgggc
agctacaagcagtgggatgagccacggcgtatggatttcctagtcaatgagctgactggg
aagcgccccctgctgccgcctgatcttcccatgacccctgaggtggcggatgtcatcggc
actttccgcatgctggcgcagctgcccactgactcgcttggtgcctacatcatctctatg
agccacaccgcctctgacgtgctggcggtggtgctgatgcagaaggagtgcggggtgaat
cccatgctgcgcgtggtgccgctgttcgagacgctggatgacctgcactatgctgagact
gccatgcgccagctgttcaccaatccctggtacctcgctcacatcaatggccagcaggag
gcaatgattggttacagcgactctggcaaggatgcggggcgcctggcggcagcatggggc
ctgtacgaggtacaggagcggctgaccaaggtggcggacgagttcgacgtgcacatgaca
ctgttccatggccgtggtggcactgtgggtcgcggaggcggccccgcccacctagccgtg
ctgtcgcagccaccaggcacgatccgtggcacaatccgtgtgacggtgcagggggaagtg
atggagcagcagtttggcgagaaggagagtgccttccataccatggacctgtacacctct
gctgtgctggaggccacactggctcccactgagcagccacctcaactatggcgcgagatg
atggcagatatggcacgtgtatcgtgtgaggcataccgagcggtggtgcaggaggaccca
cgctttgtctccttcttccagtctatcacaccagtgaatgagctgggccgcatgaacatt
ggctcccgcccagctaagcgccgttcccacggctccatcgacacgttgcgcgccatcccc
tggatattcgcttggacacaggtccgctttcacctgcccgtgtggctgggcgtgggcgag
gcactcaactccatgatcaaagcgggcaagctggagctgctgcaggacatgttcaccaac
tggatgttcttccgtgtcactctggacatgctggagatggtgttcgccaaagccgaccct
cgcgtggtcaagatgtatgagaaggcgctcgtggagcctgagttgcatggcctgggcgac
gagctgctgaagaagtttgagatggcagagcagtcgctgctgacagtcatgaagcacagc
cggctgctgagctccagctccacggccttcttgcagcagaagctgcagctgcgggcacca
tacgtcgcgccgctcaatattctgcaggtgagctgcctgaagacactgcggacgattgag
gcggggaagagcgtggatgacctagtgcccgacggatacaaacccagtgaaaaggcgctg
gcgctcatgtcgcgtggcgactcgaagcacccatttttggctggcattgaggacaccatg
atcatcacaatgaagggaatcgctgcaggaatgcagaacacagggtag

DBGET integrated database retrieval system