KEGG   Chlorella variabilis: CHLNCDRAFT_55969Help
Entry
CHLNCDRAFT_55969  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cvr  Chlorella variabilis
Pathway
cvr00020  Citrate cycle (TCA cycle)
cvr00480  Glutathione metabolism
cvr01100  Metabolic pathways
cvr01110  Biosynthesis of secondary metabolites
cvr01200  Carbon metabolism
cvr01210  2-Oxocarboxylic acid metabolism
cvr01230  Biosynthesis of amino acids
cvr04146  Peroxisome
Module
cvr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHLNCDRAFT_55969
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CHLNCDRAFT_55969
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CHLNCDRAFT_55969
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CHLNCDRAFT_55969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh Kdo
Motif
Other DBs
NCBI-GeneID: 17358921
NCBI-ProteinID: XP_005851119
JGI: ChlNC64A_1_55969
UniProt: E1Z4A2
LinkDB All DBs
Position
Unknown
AA seq 471 aa AA seqDB search
MGVSKWARAAARGCTAAHHVAWQQWSREATHVPFGRGALTRMPAGFREMASAAGKIKVEN
PVVDLDGDEMTRVIWNQIKEKLIFPYVDLKLEYYDLGLPSRDATDDQITIDAANAIKKHS
VGIKCATITPDEGRVKEFGLKKMWRSPNGTIRNILNGTVFREPIVIDNIPRLVPGWKKPI
VVGRHAFGDQYRATDFVVDGPGKLEMIFTPEGGGAPQQFTIYDFKGKRAAGLIWAGVALG
MYNTEESIRGFAESCFQYALSRKWPLYLSTKNTILKKYDGRFMQIFDEIYHTKYQTQFEN
LGIWYEHRLIDDMVAQGLKSSGGFVWACKNYDGDVQSDIVAQGYGSLGLMTSVLVTPDGR
TVEAEAAHGTVTRHWREYQKGNPTSTNPIASIFAWTRGLAHRAKLDGNEELLKFCGDMEA
AVIKTVEAGHMTKDLAICVHGTTKVTPDQYMYTEPFMDKIKETFDSLRAQA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtatctaaatgggcgcgagccgcagcgcggggttgcacagcagcccaccatgtg
gcctggcagcagtggagccgggaagccacccacgtgcccttcggacgcggggccctgacc
cgcatgcctgcaggcttcagggagatggcatctgcggcggggaagatcaaggttgagaac
ccggtggtggacctggatggggatgagatgacccgcgtgatctggaaccagatcaaggag
aagctcatcttcccgtacgtcgacctcaagctggagtattacgacctggggctgcccagc
cgcgacgccaccgacgaccagatcaccattgacgccgccaatgccatcaagaagcacagc
gtgggcatcaagtgcgccaccatcacccccgatgaggggcgcgtcaaggagtttggcctg
aagaagatgtggcgctcccccaacggcaccatccgcaacatcctcaacggcaccgtgttc
cgggagccgattgtgatcgacaacatcccgcgcctggtgccggggtggaagaagcccatc
gttgtgggcaggcacgcgtttggcgaccagtaccgcgccaccgactttgtggtggatggg
cccggcaagctggagatgatctttacgccggagggaggcggcgcgccccagcagttcacc
atctacgacttcaagggcaagcgcgccgctggcttgatctgggcgggcgtggcgctgggc
atgtacaacacagaggagtcgatccgcggctttgcagagtcgtgcttccagtacgcgctg
tcccgcaagtggccgctgtacctgtccaccaagaacacgatcctgaagaaatacgatggg
cggttcatgcagatctttgacgagatctaccacaccaagtaccagacgcaatttgagaac
ctgggcatctggtatgagcaccgcctgattgacgacatggtggcccagggcctcaagtcc
agcggcggctttgtgtgggcctgcaagaattacgacggcgacgtgcagagcgacatcgtg
gcgcagggctacggctcgctaggcctcatgacctcggtactggtcacacccgacgggcgc
accgtggaggcggaggcggcgcacggcacggtgacgcggcactggcgcgagtaccagaaa
ggcaaccccacctccaccaaccccattgcctccatctttgcctggacccgcggcctggcc
catcgcgccaagctggacggcaacgaggagctgctcaagttctgcggggacatggaggcg
gctgtgatcaagactgtggaggcggggcacatgaccaaggacctggccatctgcgtgcac
ggcaccaccaaggtcactcccgaccagtacatgtacacagagcccttcatggacaaaatc
aaggagacgtttgactcgctgagggcccaggcatga

DBGET integrated database retrieval system