KEGG   Chlorella variabilis: CHLNCDRAFT_56196Help
Entry
CHLNCDRAFT_56196  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cvr  Chlorella variabilis
Pathway
cvr00020  Citrate cycle (TCA cycle)
cvr00190  Oxidative phosphorylation
cvr01100  Metabolic pathways
cvr01110  Biosynthesis of secondary metabolites
cvr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHLNCDRAFT_56196
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CHLNCDRAFT_56196
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CHLNCDRAFT_56196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA
Motif
Other DBs
NCBI-GeneID: 17354267
NCBI-ProteinID: XP_005846959
JGI: ChlNC64A_1_56196
UniProt: E1ZH40
LinkDB All DBs
Position
Unknown
AA seq 558 aa AA seqDB search
MLQGAGGAGLRAAVGLSEGGFSTACITKLFPTRSHTVAAQGGINAALGNMTEQPARSAAA
ADAALARRPCPPAADPQRAFGGQSLDFGRGGQAYRCCAAADRTGHAMLHTLYGAAMKHNC
NFFVEYLALDLIMDQDGSCRGVIALCMEDGTLHRFRAHNTILATGGYGRAYFSATSAHTC
TGDGNAMAARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAP
TAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAG
VDVTKEPIPVIPTVHYNMGGVPTNYHGEVVVPKDGNPDAVVPGLMAAGEAASASVHGANR
LGANSLLDIVVFGRACALRVGEILKPGTPHKPLPADAGQETIARLDKLRHANGSMTTATI
RRNMQKIMQNNAAVFRTQETLAEGCDLIDECAATYQDIKLADRGLVWNTDLVEALELENL
LMNAAVTMHSAEQRKESRGAHAREDFTARDDKDWMKHTLGWFDWSAPGANKVKIDYRPVH
MQPLTKDMDHIPPKARVY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagggtgccggtggcgcgggcctgcgcgcggcggtgggtttgtctgagggcggc
tttagcacagcgtgcatcaccaagctgttccccacccgcagccacaccgtggcagcgcag
ggcggcatcaacgcagcgctaggcaacatgacggagcagcccgcccggtcggcagctgcc
gcagacgccgctttagcccgccggccctgcccccccgccgccgacccgcagcgcgccttt
ggcggccagagcctcgactttgggcgtggcgggcaggcgtaccgctgctgcgcggccgcc
gaccgcacggggcacgccatgctgcacacgctctatggagcggccatgaagcacaactgt
aattttttcgtggagtacctggctttggacctcatcatggaccaggacggctcctgccgc
ggcgtgattgcgctgtgcatggaggacggcacgctgcaccgcttccgcgcacacaacacc
atcctggccacgggcggctacggccgcgcctacttctccgccacctccgcacacacctgc
accggcgacggcaacgccatggcggcgcgcgcgggcctgccgctgcaggacctggagttt
gtgcagttccaccccacaggcatctacggcgccgggtgcctgatcaccgagggcagccgc
ggcgagggcggcatcctgcgcaacagcgagggcgagcggttcatggagcggtacgcgccc
accgccaaggacctggcctcacgagacgtcgtgtcccgctccatgaccatggagatccgc
gaggggcgcggcgtgggccccgagaaggaccacatctacctccacctcaaccacctgccc
cccgagctgctggcggagcggctgccgggcatctccgagacggcggccatctttgcgggg
gtggacgtcaccaaggagcccatccccgtcatccccacggtgcactacaacatgggcggc
gtgcccaccaactaccacggcgaggtggtggttcccaaggacggcaaccccgacgcggtg
gtgcctgggctgatggcggcgggcgaggccgcctccgcctctgtgcacggcgccaaccgg
ctgggcgccaactcgctgctggacattgtggtgtttgggcgggcctgcgcgctgcgggtg
ggcgagatcctgaagcccggcacgccgcacaagccgctgcccgccgacgccggccaggag
acgatcgcgcgcctggacaagctcaggcacgccaacggcagcatgaccaccgccaccatc
cggcgcaacatgcagaagatcatgcagaacaacgccgccgtgttccgcacgcaggagacg
ctggcagaggggtgcgacctgatcgacgagtgcgccgccacataccaggacatcaagctg
gctgaccgcggcctggtgtggaacaccgacctggtggaggcgctggagctggagaacctg
ctgatgaacgcggcggtgacgatgcacagcgcggagcagcgcaaggagagccgcggggcg
cacgcgcgcgaggacttcaccgcccgcgacgacaaggactggatgaagcacacgctgggc
tggtttgactggagcgcgccgggggccaacaaggtcaagattgactaccgccccgtgcac
atgcagcccctgaccaaggatatggatcacatcccacccaaggcacgcgtgtactga

DBGET integrated database retrieval system