KEGG   Corynebacterium vitaeruminis: B843_02165Help
Entry
B843_02165        CDS       T03042                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cvt  Corynebacterium vitaeruminis
Brite
KEGG Orthology (KO) [BR:cvt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cvt03012]
    B843_02165
   03029 Mitochondrial biogenesis [BR:cvt03029]
    B843_02165
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cvt04147]
    B843_02165
Translation factors [BR:cvt03012]
 Eukaryotic Type
  Elongation factors
   B843_02165
 Prokaryotic Type
   B843_02165
Mitochondrial biogenesis [BR:cvt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B843_02165
Exosome [BR:cvt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B843_02165
  Exosomal proteins of breast cancer cells
   B843_02165
  Exosomal proteins of colorectal cancer cells
   B843_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHI21825
UniProt: W5XYS6
LinkDB All DBs
Position
452340..453530
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNQAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIIHISALKAL
EGDPKWTQSILDLMQACDDSIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGSLKV
NEDVEIIGIREKAIQTTVTGIEMFRKLLDYTEAGDNCGLLLRGVKREDVERGQVVIKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtactaagccgcacgttaacatcggcaccattggtcac
gtcgaccacggcaagaccaccaccaccgctgctatcaccaaggtgctggccgatgcttac
cctgatctgaaccaggctttcgctttcgatgccatcgacaaggcaccggaggagaaggag
cgtggcatcacgatcaacatctcccacgtcgagtaccagaccgagaagcgccattacgca
cacgtcgacgctcctggtcacgctgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgcaatcctcgtggttgccgccaccgacggcccgatgccgcagacccgtgag
cacgttctgctcgctcgccaggttggcgttccgtacatccttgttgccctgaacaagtgc
gacatggttgacgacgaggagatcatcgagctcgtcgagatggaggtccgcgagctgctg
gccgagcaggactacgatgaggatgccccgatcatccacatctccgctctgaaggctctc
gagggcgacccgaagtggacccagtccatcctcgacctcatgcaggcttgcgacgactcc
atcccggatccggttcgcgagaccgacaagccgttcctgatgccgatcgaggacatcttc
accatcaccggccgcggtaccgttgttaccggccgtgttgagcgtggctccctgaaggtc
aacgaggacgtcgagatcatcggtatccgcgagaaggctatccagaccaccgtcaccggt
atcgagatgttccgcaagctgctcgactacaccgaggctggcgacaactgtggtctgctg
ctccgtggtgtcaagcgcgaggacgtcgagcgcggccaggttgtcatcaagccgggcgct
tacactcctcacaccgagttcgagggctccgtctacgtcctgtccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtt
accggtgtcgtgaagctgcctgagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagccggtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system