KEGG   Corynebacterium vitaeruminis: B843_09660Help
Entry
B843_09660        CDS       T03042                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
cvt  Corynebacterium vitaeruminis
Pathway
cvt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cvt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B843_09660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cvt02000]
    B843_09660
Transporters [BR:cvt02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    B843_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 ATP-synt_ab SMC_N AAA_29 AAA_24 AAA NACHT AAA_16 Pox_A32 AAA_22 AAA_19 Zeta_toxin AAA_30 MobB TniB AAA_33 AAA_28 RsgA_GTPase NB-ARC G-alpha cobW
Motif
Other DBs
NCBI-ProteinID: AHI23317
UniProt: W5Y278
LinkDB All DBs
Position
2148381..2149832
Genome map
AA seq 483 aa AA seqDB search
MNTLEVRDLGVAGVVHDVSFDIAPGERVGLIGESGSGKTLTALSVMRLIDAEGSISLGGT
DLQALSEKDLCGVRGKKVAMVFQEPMTALNPLRCVGKQIVEAIRIHRRTSRVAAKHEALQ
LLADVDLRPELFGRYPHELSGGQRQRVIIAMALAHNPELLICDEPTTALDVTSQKAIIDL
ILRLVADRGMSLLFITHDLGLVARTCQRVLVMKNGAIVEEGPTTHVLAAPEHEYTRSLVA
ASTLPAARPAKHSEQVLITVDHATKMFRKTAAVSDVSLTVHRGERLGIVGGSGSGKTTLL
KMIAGLSAPTTGTVTVDGDMQMVFQDPMGSLDPRMTITDIVSETLPRRDDARVAEVLDQV
GVDAATATRLPHEFSGGQRQRISIARAIAPKPRILLADEPVSALDVSVRKKVLALIDSLV
AEEDLTLVFVSHDIAVVRSVCTQVAVMKDGEIVEYGPVEKVLHEPEHPYTRKLIDAVPSL
TTS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaacactctggaagtgcgcgacctcggcgtcgccggcgtggtccacgacgtgagcttc
gacatcgcccccggcgagcgcgtcgggctcatcggcgagtcgggctcgggcaagacgctg
accgccctgtccgtcatgcggctgatcgacgccgaaggctccatcagcctgggcggcacc
gacctccaagccctgtccgagaaggacctgtgcggcgtccgcggcaagaaggtcgcaatg
gtattccaggagccgatgaccgcgctcaacccgctgcgctgcgtcggaaagcagatcgtg
gaggccatccgcatccaccgacgaacctcgcgcgtcgcggcgaagcacgaggcgttgcaa
ttgcttgccgacgtcgaccttcggccggagctcttcgggcgctacccgcacgagctgtcc
ggcggccagcgccagcgggtcatcatcgccatggcgctggcgcacaaccccgagctgctc
atctgcgacgagcccaccaccgccctggatgtgaccagccagaaggcgatcatcgacctc
atcctgcggctcgtcgccgaccgcggcatgtcgctgctgttcatcacccacgacctcggt
ctggtggccaggacctgccagcgggtgctcgtgatgaaaaacggcgcgatcgtcgaggag
ggccccaccacccacgtgctcgccgccccggagcacgagtacacccgctcgctggttgcg
gcctccacgctgcccgcggcgcgcccggcgaagcacagcgagcaggtgctcatcaccgtc
gaccacgcgaccaagatgttccgcaagaccgcggcggtcagcgacgtctcgctcaccgtc
caccgcggcgagcggctcggcatcgtgggcggctcgggctcgggcaagaccactttgttg
aagatgatcgcgggcctttccgcccccaccaccggcaccgtgacggtcgacggcgacatg
cagatggtgttccaggatcccatgggctcgctggaccccaggatgacgatcaccgacatc
gtctccgagacgctcccgcgccgcgacgacgcccgcgtggccgaggtgctcgatcaggtg
ggcgtggatgccgcgacggcgaccaggctcccccacgagttctccggcggccaacgccag
cgcatctccatcgcccgcgcgatcgcgccgaagccgcgcatcctcttggccgacgagccg
gtgtccgccctcgacgtctcggtgcgcaagaaggtgctcgcgctcatcgactcgctggtc
gccgaggaggacctcacgctcgtcttcgtctcccacgacatcgccgtggtgcgctcggtg
tgcacgcaggtcgcggtgatgaaggacggggagatcgtcgagtacgggccggtggagaag
gtgcttcacgagccggagcacccgtacacgcgaaagctcatcgacgcggtcccgagcctt
actaccagctag

DBGET integrated database retrieval system