KEGG   Crocosphaera watsonii: CwatDRAFT_1032Help
Entry
CwatDRAFT_1032    CDS       T05097                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00010  Glycolysis / Gluconeogenesis
cwa00053  Ascorbate and aldarate metabolism
cwa00071  Fatty acid degradation
cwa00280  Valine, leucine and isoleucine degradation
cwa00310  Lysine degradation
cwa00330  Arginine and proline metabolism
cwa00340  Histidine metabolism
cwa00380  Tryptophan metabolism
cwa00410  beta-Alanine metabolism
cwa00561  Glycerolipid metabolism
cwa00620  Pyruvate metabolism
cwa00625  Chloroalkane and chloroalkene degradation
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01120  Microbial metabolism in diverse environments
cwa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CwatDRAFT_1032
   00053 Ascorbate and aldarate metabolism
    CwatDRAFT_1032
   00620 Pyruvate metabolism
    CwatDRAFT_1032
  Lipid metabolism
   00071 Fatty acid degradation
    CwatDRAFT_1032
   00561 Glycerolipid metabolism
    CwatDRAFT_1032
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CwatDRAFT_1032
   00310 Lysine degradation
    CwatDRAFT_1032
   00330 Arginine and proline metabolism
    CwatDRAFT_1032
   00340 Histidine metabolism
    CwatDRAFT_1032
   00380 Tryptophan metabolism
    CwatDRAFT_1032
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CwatDRAFT_1032
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CwatDRAFT_1032
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CwatDRAFT_1032
Enzymes [BR:cwa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CwatDRAFT_1032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC RAC_head
Motif
Other DBs
NCBI-ProteinID: EAM48560
UniProt: Q4BXC8
LinkDB All DBs
Position
complement(1653..3047)
AA seq 464 aa AA seqDB search
MLKTDSIDIVIRKQRDFFSSGTTQDINFRKQQLKNLRNLIDDNENEILEALHKDLKKTEF
EGCLTAVIGAKIEIDYALKNINKWTKAKKVSVPIDQLPGKAFIQPQAKGVVLIISPWNYP
FHLAIVPLVGAIAAGNCAIIKPSELTPNTSKVIAKIINNNFDENYIRVIEGAKETSQKLL
EQKFDHIFFTGGSSIGKIVMEAAAKHLTPVTLELGGKSPCIIDTNINVKETAKRIAWGKF
LNNGQTCVAPDYLLVNRQIKKELLEAIIEATKNLYGDDPATSPDYGRIVNHHHFNRLCAL
LEPGKIVLGGQVIPEENYISPTIIDEVSPDFPIMEDEIFGPILPILEYDRLEEAIAFINE
RPRPLALYLFSNDKKQQKIIVQKTISGGVCINHTIMHLGVLDLPFGGVGNSGMGSYHGKA
SFDTFSHQKSVLKRSFFLGTDLLFPPYKDKLKWIKLGLCIKNNC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacagatagtattgatatagtaatcagaaaacaacgtgatttcttttcctca
ggaacgacacaagatattaattttcgtaagcaacaacttaaaaatttacgaaacttgata
gatgacaatgaaaatgagatactagaagcattacataaagacttaaaaaaaactgaattt
gaagggtgtttaaccgctgttattggagccaaaatagagattgattatgcccttaaaaat
atcaataaatggacaaaagctaaaaaagtttctgttcctattgatcaattaccaggcaag
gcatttatacagcctcaggccaaaggagttgttcttattattagtccttggaattatcca
tttcatttagctattgtccctttagtgggggctatcgctgctggaaactgtgctattatt
aaaccttcagaactaacaccaaatacatcaaaagtgatcgcaaaaataataaataataac
ttcgatgaaaactacataagggttatagaaggagccaaagaaaccagtcaaaaattatta
gaacaaaaatttgatcatattttctttacaggtggttcttccatcggcaaaattgtaatg
gaagctgctgctaaacatttaactccagtgactttagaattaggggggaaaagcccttgt
attatcgatacaaatatcaatgtgaaagaaacagcaaaacgtatcgcctggggaaaattc
ttaaataatggacaaacctgtgtagctccagattacttattagtcaatcgccagataaaa
aaagaacttttagaggcaataatcgaagcaactaaaaacctatatggagacgaccctgca
accagtccagactatggaagaattgtcaatcatcatcactttaatagattgtgtgcttta
ttagaaccaggtaaaattgttttaggaggtcaagttataccagaagagaactatatttct
ccgacaattatcgatgaagtttctcctgattttcctatcatggaagacgagatatttggt
ccaattttacccatcttagaatacgatcgactagaagaagctattgcttttataaacgaa
agaccgagaccccttgctctctatttattttctaatgacaaaaaacagcaaaaaatcata
gtacaaaagaccatatcgggaggagtttgtattaaccatacaataatgcacttaggggtg
cttgaccttcccttcggtggtgtaggtaacagtgggatgggttcttatcatggcaaagcc
agctttgacaccttttctcatcagaaaagtgtcttaaaacgttccttcttcctaggaaca
gatttacttttcccaccctataaggataaattaaagtggataaaacttggactttgtata
aaaaacaattgttag

DBGET integrated database retrieval system