KEGG   Crocosphaera watsonii: CwatDRAFT_2418Help
Entry
CwatDRAFT_2418    CDS       T05097                                 

Definition
(GenBank) Protein kinase
Organism
cwa  Crocosphaera watsonii
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH DUF4755 PIP49_C BUD22
Motif
Other DBs
NCBI-ProteinID: EAM49890
UniProt: Q4C138
LinkDB All DBs
Position
complement(14197..15102)
AA seq 301 aa AA seqDB search
MIPSYRKDSLEQHYKIINQLGKGAMGITYAAEDVNTGQKIALKVISLQNLSDAKHLELLE
REVTVLKQLNHPNIPQYIDYFQLKEDNKLYLVQELVLGKNLNQQVESGLRLTEGEVKNIA
QQVLYILDYLHNFQPSIIHRDIKPHNLILGDDVKIFLVDFGAVHNAYYNTMIGGTVGIGT
IGYMSPEQQIGKPVPASDLYSLGRTLLYLLTNRPPDHLLAHKETVNLDHIRDYIQLSDEF
IQWLEKILDPDVDERFYSAKEALNSLKNTKSINKEKNSQIGWFALICLGVASVTLGTFSY
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgataccttcctaccgaaaagactcccttgaacaacattataaaattattaaccaactc
ggtaagggagcaatgggaataacttatgcagcagaagatgtcaacacaggtcaaaaaatc
gctctcaaagtcatctcgttacagaatctaagcgatgctaaacatctagaattattagaa
cgagaagttacagttttaaagcaattaaatcatcccaatattcctcaatatattgattac
tttcaattaaaagaagataataaattataccttgtacaagagttagtgctaggaaaaaat
ctaaatcagcaagtagaatcaggactgagattaacagaaggagaagttaagaatatcgca
caacaagttctttacattcttgactatttgcacaattttcaacctagtattattcaccga
gatattaaaccccataacttgattcttggggatgatgtaaaaatatttttagtagatttt
ggtgcggttcataatgcttattataataccatgatagggggaacagttggcattggaacc
attggttatatgtccccggaacaacaaataggtaaacccgttcctgcttctgacttatat
agtttagggagaacattactttatctattaaccaatcgtcctcccgatcatttattggcg
cataaagaaacagttaatcttgatcatattcgtgattatattcaactatctgatgaattt
atacagtggttagaaaagatattagatcctgatgtagatgagcgtttttattcagcaaaa
gaagcattgaactcattaaaaaatactaagtcaattaacaaagaaaaaaatagtcaaatt
ggatggttcgctttgatatgtctaggagttgctagtgttacattagggactttttcttat
aattag

DBGET integrated database retrieval system