KEGG   Crocosphaera watsonii: CwatDRAFT_2431Help
Entry
CwatDRAFT_2431    CDS       T05097                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00620  Pyruvate metabolism
cwa00680  Methane metabolism
cwa00710  Carbon fixation in photosynthetic organisms
cwa01100  Metabolic pathways
cwa01120  Microbial metabolism in diverse environments
cwa01200  Carbon metabolism
Module
cwa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CwatDRAFT_2431
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CwatDRAFT_2431
   00680 Methane metabolism
    CwatDRAFT_2431
Enzymes [BR:cwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CwatDRAFT_2431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase DnaGprimase_HBD PEPcase_2
Motif
Other DBs
NCBI-ProteinID: EAM49612
UniProt: Q4C0D2
LinkDB All DBs
Position
complement(2119..5169)
AA seq 1016 aa AA seqDB search
MLLESLQSTVEEVNIFSTSDLFLRQRLELVESLWESVLKAECGLELVDLLKKLRKISSPE
GQVTDQPKTSINELIEELELNEAIRATRAFALYFQLINIVEQHYEQRDQQLNRRSTYQES
EKARENYQKGEKSTNGLVGADLLEKALVGETKSQEKGGTFHWLFPQLKRLNVPPQQIQRL
LEQLDIRLVFTAHPTEIVRHTIRLKQRRIATLLRRLDQAEEAFRGMGLSSSWEAESIIEQ
LNEEIRLWWRTDELHQFKPSVLDEVDYTLHYFDEVLCSALPQLSQRLQQALQANFPRIKP
PHNTFCRFGSWVGGDRDGNPFVTTDVTWRTACYQRNLILEKYLAAVEDLTEILSSSLHWS
NVSQDLLDSLERDRVAMPEIYDQLAIRYRQEPYRLKLAYIQKRLEHTRDRNNHLANPEQG
QVLVEETPENIYHSGVEFEAELQLIKRNLEETGLKCQALENLIFQAQMFGFTLTQLDFRQ
ESSRHSETIQTIASYLNILPTPYEELSEAEKVNWLVGELQTRRPLIPMEMPFDEKTIETV
ETMRMLRHLQQEFGIEICQTYIISMTNDVSDVLEVLLLAKEAGLYDPGTSTTTIRIVPLF
ETVDDLKRAPEIMEALFKLPLYRTALAGGYDYLDEDKKEQLPPPQLQPANLQEIMVGYSD
SNKDSGFLSSNWEIHKAQKSLQKIAEPHNLALRLFHGRGGSVGRGGGPAYAAILAQPTGT
INGRIKITEQGEVLASKYSLPELALYNLETATTAVIQGSLLGSGFDDIDPWNGIMEELAS
SARKAYRSLIYEQPDFLDFFLSVTPIPEISQLQISSRPARRKSGKKDLSTLRAIPWVFSW
TQSRFLLPAWYGVGTALEGFLQQEPEENLKLFKYFYLKWPFFKMVISKVEMTLSKVDLQI
AHHYVKELSNPEDIERFEKVFERISEEYHRTCEIILSITGQPKLLEGDAGLQRSVQLRNG
TIVPLGFLQVSLLKRLRQYTRQAESGVIHFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttgaatcattacagtccacagttgaagaggttaacattttttcaacatctgat
ctcttcctacgtcagcgtctggaattagtggaaagtttatgggaatcagtattaaaggct
gaatgtggcctagaattagtagacttattaaaaaaattacgaaaaatctcctcaccagaa
ggacaggttaccgatcaaccaaaaacctctatcaatgaactcatagaagagttagaactc
aatgaggctattcgtgctaccagggcatttgctctctattttcagttgattaatattgtt
gaacaacattacgaacaaagagatcagcaactgaaccgacgctctacctatcaagaatca
gaaaaagcgagagaaaattatcaaaaaggagaaaagtccactaatggcttagtgggcgca
gatttattggaaaaagctctagttggagagacaaaaagtcaggaaaagggaggaaccttt
cattggttatttccccaattaaaacgcttaaacgtccccccccaacaaattcaacgctta
ctagaacaattagatatccgcctcgtttttacagctcatcccacggagattgttcgtcat
accataagactcaaacaaagacgaatagctaccttactgcgacgtttagaccaagcagaa
gaagcatttcgaggtatggggttgagtagttcctgggaagcagaatcaattattgaacaa
ctcaacgaagaaattcgcctctggtggcgtactgatgaacttcatcagtttaaacccagt
gtcctcgacgaagtagactacaccctacactacttcgatgaagtgttatgtagtgcgctg
ccccaactctctcaaagactgcaacaggccctacaagccaattttccccgtattaaaccc
cctcacaataccttctgtcgctttggatcttgggtaggaggcgatcgggacgggaacccc
tttgttaccacagacgtaacctggcgcaccgcttgttatcaacgcaacttaattctagaa
aaatatttagcagccgtagaagacttaacagagattttaagctcatccttgcactggagt
aatgtttctcaggatctcctggactccttggaacgcgatcgcgtggccatgccagaaatt
tatgatcaactagccatacgctatcgtcaagaaccctatcgcctgaaactggcttatatt
caaaaacgcctcgaacatacacgcgatcgcaataatcatctagccaaccccgaacaggga
caagtcttagtcgaagaaaccccagaaaatatctaccactccggggtagaatttgaagca
gaattacaactaattaaacgtaatttagaggaaacagggttaaaatgccaggcattggag
aatctaatttttcaggcccagatgttcggctttaccctcacacaacttgattttcgtcaa
gaatcttcccgtcattccgaaactatccaaaccattgccagctatttaaacatcttaccc
actccctacgaagaactttccgaagcagaaaaagtcaattggttagttggggaactacaa
acccgtcgtcctttaatacccatggaaatgcccttcgatgaaaaaaccatcgaaacagta
gaaaccatgaggatgttgcgccatttacaacaagaatttggcatcgaaatttgtcaaacc
tatatcatcagcatgactaacgatgtcagcgatgtactagaggttttgttattagccaaa
gaagccggactctacgatccaggaaccagtaccaccaccattcgcattgttccccttttt
gaaaccgtagacgatttaaaacgggcccctgaaatcatggaggctttgtttaagttaccc
ttataccgaacagctttagccggagggtacgactatttagacgaggataaaaaagaacaa
ttaccaccacctcaactgcaaccggccaatctacaagagattatggtgggttattctgat
agcaacaaagactctggtttcctgagcagtaattgggaaattcataaggcacaaaaatcc
ttacaaaagatcgccgaaccacacaatttagccctgagactgtttcatggtcgtgggggt
tccgtgggacgggggggaggccccgcctacgctgctattttagcccaacccacaggtacc
attaacggacggatcaaaattaccgaacaaggagaagtcttggcctccaaatactcccta
ccagaactcgctttgtataacctagaaactgccacaacagcagtgatccaaggcagttta
ctggggagtggcttcgacgatattgacccttggaacgggatcatggaagagttggctagt
agtgcgagaaaagcctatcgcagtttaatttatgaacaacccgacttcctagactttttc
ctgtccgttaccccgatccccgaaattagccaattacagattagttctcgtcctgcccga
cggaaaagtggaaaaaaagatttaagtaccttacgggcgattccttgggtgtttagttgg
acacaaagtcgtttcctgctgccagcttggtatggagtaggaaccgccttagaagggttt
ttgcaacaggaacccgaggaaaatttgaagttgtttaaatatttttacttgaaatggcct
ttctttaaaatggtgatttctaaagtagaaatgaccctttctaaagtggatttacaaatt
gctcaccattacgtcaaggaactttccaatcccgaagatatagaaagatttgaaaaggta
tttgagcgcatttctgaagaataccatcgcacctgtgaaattattttaagcatcaccgga
caaccaaaattattagaaggagatgctggtttgcagcgatcggtacagttaagaaatgga
actattgttccccttggttttttacaagtttctctgttgaaaagattacgtcaatatacc
cgtcaagcagagtcaggagtcattcacttccgttattctaaagaagaattattacggggt
gcattactcactattaatggtattgcagcaggaatgcgtaacactggttga

DBGET integrated database retrieval system