KEGG   Crocosphaera watsonii: CwatDRAFT_2673Help
Entry
CwatDRAFT_2673    CDS       T05097                                 

Definition
(GenBank) similar to Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CwatDRAFT_2673
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cwa02000]
    CwatDRAFT_2673
Enzymes [BR:cwa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CwatDRAFT_2673
Transporters [BR:cwa02000]
 Other Transporters
  Pores ion channels [TC:1]
   CwatDRAFT_2673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_N GST_N_4 Glutaredoxin GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: EAM49760
UniProt: Q4C0U5
LinkDB All DBs
Position
2281..3480
AA seq 399 aa AA seqDB search
MTTSPLSWTELENLTNWTKDNINGPTNSQAILRLFGHQESDIRVTLYRDNHAWCPYCQKV
WLWLEEKQIPYRIEKVTMFCYGTKERWYKKIVPSGMLPALELDGRIITESDDILQSLETA
FGPLTHSMKDAKVIPLRQLERLLFRAWCGWLCYPTWSQKQELQNREQFVKVVAMVEKALA
DTPSPYFLEEFSIVDVIFTPYVERMNASLYYYKGYSLREENERFGQWFDAMETRPTYRGT
QSDFHTHVHDLPPQMGGCYSNSEEQAKINQDRVDNGSWFGLPDVMYAEPENSRQEALQRV
IKHRENIIRVNPAKDKVFDEALRCALTTMMTEETCQPPNGSDVALRYLRDRINVPRDMSI
YAGKRLRDALETTASLVGDRQGIPIPIKHRRDQDPTNFV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcgcctttaagctggacagaactagaaaacctaaccaactggacaaaagat
aatattaatggaccaactaactcccaagctattttacggctttttggtcatcaagaaagt
gatatcagagtcaccctttaccgtgataaccatgcgtggtgtccctactgtcaaaaagtt
tggttatggttagaagaaaaacaaattccctaccgtatcgaaaaagttaccatgttttgc
tacggaacaaaagaacgctggtataaaaaaattgtaccatcaggaatgcttcctgctcta
gaattagatggacgcattattaccgaaagtgatgatattttgcagtccctagaaacagcg
tttggccccttaacccatagcatgaaagatgcaaaggttattcctttaagacagttagaa
aggttactatttcgggcctggtgtggttggttgtgttaccccacttggtcacaaaaacag
gaactacaaaaccgtgaacagtttgttaaagttgtggctatggtagaaaaagctttagct
gataccccaagtccctattttctcgaagagtttagcatagtagatgtgatttttacgccc
tatgttgagcgcatgaacgctagtttatactactataagggttattctttgcgagaggaa
aatgaacgttttggtcagtggtttgatgcgatggaaacccgtcccacttatcggggaact
caaagcgactttcatacccatgttcacgacttacccccacaaatgggtggatgttacagc
aatagcgaagaacaagcaaaaattaaccaagatagggtagataatggttcttggtttggt
ttacctgatgtgatgtatgctgaacccgaaaactcccgtcaagaagctttgcaacgggtg
attaaacaccgtgagaatattattcgggttaaccctgcaaaagataaagtgttcgatgaa
gcgttacgttgtgcattaactaccatgatgacagaggaaacctgtcaacctcccaatgga
tctgatgttgccttacgatatttacgggatagaattaatgtaccacgagatatgtccatc
tatgcaggaaaacggttacgggacgcattagaaactactgctagtttagtcggcgatcgc
caaggaatacccattcctattaaacatcgacgggatcaagatccgactaattttgtttaa

DBGET integrated database retrieval system