KEGG   Crocosphaera watsonii: CwatDRAFT_4357Help
Entry
CwatDRAFT_4357    CDS       T05097                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00473  D-Alanine metabolism
cwa00550  Peptidoglycan biosynthesis
cwa01100  Metabolic pathways
cwa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CwatDRAFT_4357
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CwatDRAFT_4357
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CwatDRAFT_4357
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cwa01011]
    CwatDRAFT_4357
Enzymes [BR:cwa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CwatDRAFT_4357
Peptidoglycan biosynthesis and degradation proteins [BR:cwa01011]
 Precursor biosynthesis
  Amino acid ligase
   CwatDRAFT_4357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK DUF2148
Motif
Other DBs
NCBI-ProteinID: EAM51300
UniProt: Q4C512
LinkDB All DBs
Position
96532..97581
AA seq 349 aa AA seqDB search
MAKIRIGLLFGGRSGEHEVSINSAQAIAQALQTGENDHKYDVIPVYIQKNGVWIAGETAD
EVLESKTPLSPEDTNPYQLWQFPPELQEVEVWFPVLHGPNGEDGTIQGLLTLMQVPFVGS
GVLGSAVGMDKIAMKMAFAQAGLPQVKYKAVERSQIWSNPCIFPKLCDDIEAGLGYPCFV
KPANLGSSVGIAKARSHSELEAALDSAASYDRRIVIEAGVTARELECAVLGNDNPKASVV
GEITFDSDFYDYETKYTEGRSQIHIPASLPEKVIKQIQEMAIQAFKTVDASGLARVDFFY
VEETQAIYLNEINTLPGFTKFSMYPQLWQATGISFEQLVDKLIQLALEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatacggataggattgttattcggtggaagatcaggagaacacgaggtttct
attaattcggcacaagccattgcccaagctttgcaaacaggagaaaatgaccataaatac
gatgttattccggtgtacatccaaaaaaatggcgtttggatcgcaggagaaacagccgat
gaagtcctagaaagtaaaactcctctttctccggaagacacaaacccttatcaattatgg
cagtttcctccagaacttcaagaggtagaggtgtggtttcccgtgttacatggccccaat
ggggaagatggcaccattcaagggttattaaccttaatgcaggttccttttgtgggcagt
ggggtgttaggatcggccgtaggcatggacaaaattgccatgaaaatggcctttgctcaa
gccggactcccccaagttaagtataaggccgttgagcgatcgcaaatctggtctaacccc
tgtatttttcctaaactttgtgacgacatcgaagcagggttaggctatccttgctttgtc
aaaccagctaatctgggatcgtcggtgggtattgctaaagcgcgatcgcattctgagtta
gaagcagctttagatagtgcggccagttatgatcgacgtattgttatcgaagcaggagtt
acggccagagagttggaatgtgctgtgttaggcaatgataaccccaaagcttctgtggta
ggagaaattacttttgatagcgatttttatgactacgaaactaagtatacagaaggtcgt
tctcagatacatattcctgctagtttaccagaaaaagtcatcaaacaaattcaagaaatg
gccatacaagctttcaaaacagtcgacgcttctggtttagcgagagtggactttttctat
gtagaagaaacccaagcaatttatctcaatgaaattaataccttaccagggtttactaaa
tttagtatgtatcctcaactgtggcaagcaacaggcatcagttttgaacaattagtggat
aaattaatacaattagccttagaaaaataa

DBGET integrated database retrieval system