KEGG   Citrobacter werkmanii: CO701_00800
Entry
CO701_00800       CDS       T05129                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00052  Galactose metabolism
cwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CO701_00800
Enzymes [BR:cwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     CO701_00800
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_31 ADH_zinc_N_2 MTS TrkA_N Methyltransf_25 2-Hacid_dh_C UDPG_MGDP_dh_N PrmA Methyltransf_24 Methyltransf_12 Methyltransf_11 CoA_binding ELFV_dehydrog Pyr_redox_2 Shikimate_DH Fer4_4
Other DBs
NCBI-ProteinID: ATF47793
LinkDB
Position
complement(151654..152697)
AA seq 347 aa
MKSVVIHAEGDVRVEERPIPQLQTEDDVLVRVASSGLCGSDIPRIFNHGAHYYPITLGHE
FSGYVESYGAGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIDDGVFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLAMQCA
RELGANSITAIDINPQKLALAKELGATHVFNSREMNAAEIHAGLENFQFDQLVLETAGTP
QTVTLSIEIAGPRAQLALVGTLHHDLALSAGVFGQILRKELTILGSWMNYSSPWPGEEWE
TAARLLTEKCLRLEPLIAHNGDAESFASAVKSLNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgtgttgaagaacgtcccatacca
cagttgcaaactgaagacgatgtgttagtcagggttgctagctcaggcctttgcggttca
gatattccgcgtatttttaatcatggcgcacactattatccaataacgctgggccatgaa
tttagcggctatgttgaatcctatggagcaggcgttactgatatgcaacccggcgatgcc
gttgcctgcgttcctctactcccctgctttcattgtccgcagtgcgaacgcggatacttc
tcgctgtgcaagcaatatcaatttgtcggttcacgcagcgaaggaggtaacgcggaatat
gtggttgtaaaacgcgccaacctgttccgcctaccttcagatatgccaatagatgatgga
gtatttatcgaacctatcaccgtcggcctgcatgcgtttcacctggcgcagggttgcgaa
ggcaaaaatgtgattattgtgggtgctggtactatcggcttgctggcaatgcaatgcgct
cgtgaacttggtgcaaatagtattacggcaattgatatcaacccgcaaaagctggcatta
gcaaaagaactgggggcaacccatgtgtttaatagccgggagatgaatgcggccgagatc
cacgctggtctggagaattttcagtttgaccaactcgtactggaaactgcgggaaccccg
caaaccgtgacgctgtcgattgagattgccggtcctcgtgcccaactggcgttagtcggt
acgttgcatcacgatcttgcgctctcagctggtgtatttggacaaatattgcgtaaagag
ttaaccattctcggcagttggatgaactattccagcccatggccgggagaagaatgggaa
accgcagcgcgtttgctaacagaaaaatgcttacggctggagccattaatcgcccacaac
ggtgatgcagagagctttgccagtgccgttaagtcactcaatggcgcaccgatgcaggga
aaaatcctgcttaaactctcctga

DBGET integrated database retrieval system