KEGG   Citrobacter werkmanii: CO701_09930Help
Entry
CO701_09930       CDS       T05129                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00473  D-Alanine metabolism
cwe01100  Metabolic pathways
cwe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CO701_09930
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CO701_09930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cwe01011]
    CO701_09930
Enzymes [BR:cwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CO701_09930
Peptidoglycan biosynthesis and degradation proteins [BR:cwe01011]
 Precursor biosynthesis
  Racemase
   CO701_09930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DnaA_N
Motif
Other DBs
NCBI-ProteinID: ATF49424
UniProt: A0A291CZB3
LinkDB All DBs
Position
complement(1992037..1993263)
Genome map
AA seq 408 aa AA seqDB search
MAAPLGRLALIPLFLITACHQPVPTSQTGPVPYAVSKQVVVDNTTLEISRSALEYNVHKV
QQLLGDKTRLCAILKGDAYGHDLSLVTPVMMQNGVQCIGVASNEEISIVRQADFTSQLMR
VRNATEKEMRQAADFDTEELIGNLDMAKRLSAIAQEKGKTIRIHLALNSGGMSRNGLEVS
TAAGLEEARAISALPGLKIVGIMSHFPEEDAAVVKRDLARFNTQSAQVLKITGLKREDVT
LHVANTFATLTVRESWLDLVRVGGIFYGDTIASTEYKRVMTFKSSIASVNHYPKGNTVGY
DRTYTLKRDSVLANIPAGYADGYRRVFSNAGHVLIRGQRVPVLGKTSMNTLIVDVTDLPL
VTSGDEVVLFGKQGKAQVSAEEVEEISGALFTEMSILWGATNKRVMVD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacctttgggtcgtttagcacttatcccgctgtttctgatcaccgcctgtcac
caacccgttcccacctcgcagaccggtcccgtgccttatgcggtcagcaagcaggtggtg
gtggataataccaccctggagatctcccgcagcgcgctggaatataatgtccacaaagtt
cagcagttgctgggagataaaactcgcttgtgcgccattctcaaaggcgacgcgtacggg
cacgacctgtctctcgtcacgccggtgatgatgcaaaacggcgtgcagtgtattggcgtc
gccagtaatgaagaaatcagcatcgtgcgtcaggccgattttacatcacaactgatgcgc
gtgcgtaatgccacggaaaaagagatgcgtcaggcggcagattttgatactgaggagctg
attggcaatctggacatggcgaaacgtctgagcgctattgctcaggagaaaggcaaaacc
atccgtattcatctggcattgaactctggcggaatgtcgcgcaacggtctggaagtcagc
acggcggccggactggaagaagcccgcgctatttcggccttacctggactgaaaattgtc
ggcatcatgtcgcatttcccggaagaagatgccgcggtggtcaagcgcgatttggcccgc
ttcaatacccaatcagcccaggttctcaagattaccgggctgaaacgcgaagacgtgacg
ttgcatgtggccaataccttcgccacgctgaccgtgcgtgaatcatggctggatctggtg
cgcgttggcgggattttttatggtgataccatcgccagcacagaatacaaacgcgtgatg
acgtttaaatcatcgattgcgtcggtaaaccattacccgaaaggtaataccgtcggctat
gaccgtacatatacactcaaacgcgattccgttctcgctaacattcctgcaggttatgct
gacggctatcgtcgcgtgttcagcaacgcagggcatgtgctgatccgcggccagcgggta
cctgtgctgggtaaaacgtcaatgaatacgctgattgtcgatgtgaccgatttgccgctg
gtgacctctggtgatgaggtggtgctgttcggtaaacagggcaaggcgcaagttagcgca
gaggaagtggaagaaatcagcggcgcgctgttcaccgaaatgtcgattctatggggcgcg
acgaacaaacgggtaatggtcgattaa

DBGET integrated database retrieval system