KEGG   Citrobacter werkmanii: CO701_11050Help
Entry
CO701_11050       CDS       T05129                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cwe  Citrobacter werkmanii
Brite
Enzymes [BR:cwe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CO701_11050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATF49628
LinkDB All DBs
Position
2217863..2218444
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGELAEAIVASFGSFADFKAQFTDAAIKNFG
AGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattacctgcattaccgtatgccaaagatgctctggcgccgcacatttct
gctgaaacgctggaataccactatggcaaacaccaccagacttacgttactaacctgaat
aacctgatcaaaggcacggcgtttgaaggcaaatcactggaagagatcgtacgtagctct
gaaggtggtgtgtttaacaacgcggctcaggtctggaaccacaccttctactggaactgc
ctggcacccaacgcgggcggcgaaccgaccggtgaactggctgaagccattgttgcatct
tttggtagcttcgctgacttcaaagcgcaattcaccgatgcggcgatcaaaaacttcggc
gctggctggacctggctggtaaaaggtactgatggcaaactggctatcgtttccacgtca
aatgccggaacaccgctgaccaccgatgcaacgccgctgatgaccgttgatgtgtgggaa
cacgcttactacatcgactatcgcaacgcgcgtcctggctacctggaacatttctgggcg
ctggtgaactgggagtttgttgcgaaaaacttcgcagcataa

DBGET integrated database retrieval system