KEGG   Citrobacter werkmanii: CO701_11210Help
Entry
CO701_11210       CDS       T05129                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00250  Alanine, aspartate and glutamate metabolism
cwe00410  beta-Alanine metabolism
cwe00640  Propanoate metabolism
cwe00650  Butanoate metabolism
cwe01100  Metabolic pathways
cwe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CO701_11210
   00650 Butanoate metabolism
    CO701_11210
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CO701_11210
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CO701_11210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cwe01007]
    CO701_11210
Enzymes [BR:cwe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CO701_11210
Amino acid related enzymes [BR:cwe01007]
 Aminotransferase (transaminase)
  Class III
   CO701_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATF49653
UniProt: A0A291CZN7
LinkDB All DBs
Position
complement(2249285..2250550)
Genome map
AA seq 421 aa AA seqDB search
MNNKNLQQRRLDATPRGVGVMCDFFAQSAENSTITDIEGNQYIDFAAGIAVLNTGHRHPR
MVQAVEAQLQAFTHTAYQIVPYESYVSLAEKINAAAPIDGLRKTTFFTTGAEAVENAVKI
ARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKKGFGPFPGSVYHAPYPSELQGITTA
DSIKAIERLFKADIDASQVAAIIFEPVQGEGGFVVAPPEFVAAIRRICDEHGIVMIADEV
QSGFARTGELFAMDHYGHKADLMTMAKSLAGGMPLSGVVGKAEIMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIHDEQLCQRAAALGEQLRATLTDARAWCPELAEVRGLGSMIAAEFCD
ASTGEPSAATAQRVQKKALEQGLLLLTCGQYGNVIRFLYPLTIPQEQFVKALEIIKSVTK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaaacctgcaacaacgtcgtctggatgcaaccccgcgtggcgtgggcgta
atgtgtgactttttcgcccagtcggcagaaaacagcaccattaccgatatcgaaggcaat
caatatattgattttgctgccgggattgccgtcctgaatactggacaccgtcatcctcgt
atggtgcaggcggttgaagcacaacttcaagcctttacccacacggcctatcagattgtc
ccgtacgaaagctacgtctcgctggcggagaaaatcaatgcggccgcgccgattgacggt
ttgcgtaaaaccacgttctttaccaccggcgcagaagccgtcgaaaacgcggttaaaatt
gcccgcgcgcacaccggccgtccaggtgtgatcgcgtttggcgggggatttcatggccgt
acctatatgacgatggcgctgaccggcaaggtcgcaccgtataaaaaaggcttcgggccg
ttcccgggatcggtttaccacgcaccgtatccttctgagttgcaaggcatcaccaccgcc
gattcaataaaagccatcgagcgtctgtttaaagctgatatcgacgccagccaggtcgca
gcgattatcttcgaacccgtccagggtgaagggggctttgtggtggccccacctgaattc
gttgccgctattcgccgcatctgcgatgagcacggtattgtgatgattgccgatgaagtc
cagagtggttttgcccgcaccggcgagctttttgccatggaccattacggccacaaagcc
gatctgatgaccatggcgaaaagtctggcgggcggtatgccgctgtccggcgtggtcggc
aaagccgaaattatggatgcccctgcaccgggtggtctgggcggtacctatgccggtaac
ccgctcgccgtggcggccgctcacgcggtgcttgatatcattcatgatgagcaactgtgc
cagcgagcagcggcgctgggtgaacaactgcgtgccacgctgaccgatgcccgtgcgtgg
tgtccggaacttgccgaagtgcgtgggttaggatcgatgattgccgctgagttttgtgat
gccagcaccggagagccttctgcggccacggcgcaacgcgtacagaagaaagcccttgag
cagggactgctgctgcttacctgcggccagtacggcaacgtgatccgtttcctctacccg
ctgaccattccgcaggaacagttcgtaaaagcgctggaaattattaaatccgtcactaaa
tcgtga

DBGET integrated database retrieval system