KEGG   Citrobacter werkmanii: CO701_13075Help
Entry
CO701_13075       CDS       T05129                                 

Definition
(GenBank) cystine ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
cwe  Citrobacter werkmanii
Pathway
cwe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CO701_13075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cwe02000]
    CO701_13075
   02035 Bacterial motility proteins [BR:cwe02035]
    CO701_13075
Transporters [BR:cwe02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    CO701_13075
Bacterial motility proteins [BR:cwe02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    CO701_13075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: ATF49985
LinkDB All DBs
Position
complement(2603033..2603833)
Genome map
AA seq 266 aa AA seqDB search
MKLARLGRQALMGVMAVALVAGMSAKTFADEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAEELAKHLGVKATLKPTKWDGMLASLDSKRIDVVINQVTISDERQKKYDF
STPYTVSGIQALVKKGNEGVIKTAADLKGKKVGVGLGTNYEEWLRQNVQGVDIRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTKDTLAVTGEAFSRQASGVALRKGNDDLLKAVD
AAIAEMQKDGTLKALSEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacgtctgggacgtcaggctctgatgggtgtaatggctgtggcacttgtc
gccggtatgagcgcaaaaacatttgccgacgaaggtctgttaaataaagtgaaagagcgc
ggtacgctgttggtgggcctggaagggacctatcccccgtttagttttcagggtgatgac
ggcaagctgaccggttttgaagtcgaatttgccgaagaactggccaagcatctcggggtg
aaagcgacgctgaagccgaccaagtgggatggcatgctggcctctttagactccaaacgt
attgatgtggtgattaaccaggtaaccatctctgacgaacgtcagaaaaaatacgatttc
tctaccccatatacggtctctggtatccaggcgctggtgaaaaaaggcaacgaaggcgtg
attaaaaccgcggctgacctgaaaggcaaaaaagtcggcgtcggtctgggtaccaactac
gaagagtggctgcgccagaacgtgcagggcgttgatattcgtacctatgatgatgacccg
accaaatatcaggatctgcgcgtcggtcgtatcgatgcgattctggttgatcgtctggcc
gcgttggatctggtgaagaaaaccaaagacacgctggccgtgaccggtgaagccttctcc
cgccaggcatccggcgtggcattgcgtaaaggtaatgacgatctgctgaaagcggtcgat
gctgccattgcagagatgcagaaagacggtaccctgaaagccctgtctgaaaaatggttt
ggggcggatgtgacgaaataa

DBGET integrated database retrieval system