KEGG   Citrobacter werkmanii: CO701_13115Help
Entry
CO701_13115       CDS       T05129                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00500  Starch and sucrose metabolism
cwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CO701_13115
Enzymes [BR:cwe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CO701_13115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ATF49993
LinkDB All DBs
Position
2609443..2610930
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQYFHWYYPEGGQLWPELAARAGGLNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGTVATKYGDKNQLLAAIDALKHNDIAVLLDVVVNHKMGADEKEHIRVQRV
NTDDRTQIDDEIVECEAWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPTEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMDQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQNYIDQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTDTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLYFDHPNCI
AFSRSGTDDDPGCVVVLSNGDDGEKSIALGANYGNKTWRDYLGNREESVVTDENGEATFF
CNGGSVSVWVIAEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcctacgttattgcagtacttccactggtattaccctgagggcggtcagctg
tggcccgaacttgccgcacgcgcaggcggcctcaacgatatcggcatcaatatggtgtgg
ctgccgcccgcgtataaaggcgcgtccggtggctactcggttggctacgactcctacgat
ctgtttgacctcggcgagttcgaccaaaaaggcaccgtcgccaccaagtacggtgataaa
aaccagctgctggccgccattgatgcgctgaaacacaacgacattgcggtactgctggac
gtggtggtcaaccacaaaatgggggctgatgagaaagagcacattcgcgtccagcgcgta
aacaccgatgaccgcacgcagattgacgatgagattgtcgaatgcgaggcctggacccgc
tacaccttcccggcccgcgccgggcaatattcacagtttatctgggactttaaatgcttc
agcggcatcgaccatattgaaaatcccaccgaagacggcatttttaaaatcgtcaacgat
tacaccggagaaggctggaacgatcaggtggatgacgaactcggcaactttgactacctg
atgggcgaaaatatcgattttcgtaatcacgccgtcaccgaggagatcaaatactgggcg
cgctgggtgatggatcaaacccagtgcgacggctttcgcctcgatgccgtcaagcatatc
ccggcctggttttataaagagtggatcgaacacgtgcaagaggtggcccccaaaccgttg
tttatcgtcgctgaatactggtcccatgaagtcgacaaactgcaaaactacatcgaccag
gtggaggggaaaaccatgctgttcgacgcccccctgcagatgaagtttcacgaggcttca
cgtcagggacgcgattatgacatgagccagatcttcaccgatacgctggtggaagccgat
ccgttccatgcggtgacgctggtcgccaatcacgacacccagccgctacaggcgctggag
gccccggtcgaaccgtggtttaagccgctggcctacgcgctgatcctgctgcgcgaaaac
ggcgtgccgtcggtgttctaccccgatctgtacggcgcgcattatgaagataccggcggg
gatggccaaacctatcccatcgacatgccaatcattgaacagcttgatgaactgattctg
gcccgtcagcgtttcgcccacggcgtgcaaacgctgtattttgatcaccccaattgcatc
gcctttagccgcagcggtaccgacgacgaccccggctgtgtggtggtgctgtccaacggc
gatgacggcgaaaaaagcattgcgcttggcgcgaactacggcaataaaacctggcgtgac
tatctggggaatcgcgaggaaagcgtggtcaccgatgaaaacggcgaagcgacgtttttc
tgcaacggcggcagcgtcagcgtgtgggtgattgcagaggtgttgtaa

DBGET integrated database retrieval system