KEGG   Citrobacter werkmanii: CO701_21545Help
Entry
CO701_21545       CDS       T05129                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00071  Fatty acid degradation
cwe00280  Valine, leucine and isoleucine degradation
cwe00281  Geraniol degradation
cwe00310  Lysine degradation
cwe00362  Benzoate degradation
cwe00380  Tryptophan metabolism
cwe00410  beta-Alanine metabolism
cwe00640  Propanoate metabolism
cwe00650  Butanoate metabolism
cwe00903  Limonene and pinene degradation
cwe00930  Caprolactam degradation
cwe01100  Metabolic pathways
cwe01110  Biosynthesis of secondary metabolites
cwe01120  Microbial metabolism in diverse environments
cwe01130  Biosynthesis of antibiotics
cwe01200  Carbon metabolism
cwe01212  Fatty acid metabolism
Module
cwe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CO701_21545 (fadB)
   00650 Butanoate metabolism
    CO701_21545 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CO701_21545 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CO701_21545 (fadB)
   00310 Lysine degradation
    CO701_21545 (fadB)
   00380 Tryptophan metabolism
    CO701_21545 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CO701_21545 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CO701_21545 (fadB)
   00281 Geraniol degradation
    CO701_21545 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CO701_21545 (fadB)
   00930 Caprolactam degradation
    CO701_21545 (fadB)
Enzymes [BR:cwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CO701_21545 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CO701_21545 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CO701_21545 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CO701_21545 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ATF51501
LinkDB All DBs
Position
4359832..4362021
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLSAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQALK
IGLVDGIVKQEKLLEGAMAVLRQAINGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENQSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKMAGVISTIQPTLDYTGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMSAGFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDGLLADVSQPKRDFSDDEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPSVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgcccctggctcggtcaataaactcgacacggcaaccgtagccagccttggc
catgcgctggatgtgctggagaaacaacatgatttaaaagggctgctgctgcgttctaac
aaagcagcctttattgtcggtgccgatatcaccgaattcctttcactgttccttgttcct
gaagaacagctaagccagtggctgcactttgccaacagcgtctttaatcgcctggaagat
ctgcctgtcccaaccctgtctgcggtcaacggctatgcgctgggtggcggctgcgagtgc
gtcctggcgaccgactaccgtctggcaaccccggacctgcgcatcggtctaccggaaacc
aagctgggcatcatgccgggctttggcggttccgtgcgtatgccacgcatgctgggtgca
gacagcgcgctggaaatcattgctgcgggtaaagacgtcggtgccgagcaggcactgaaa
atcggtctggttgatggcattgtgaagcaggaaaaactgctcgagggcgcaatggcggta
ctgcgtcaggcaatcaacggcgacctcgactggcgggccaaacgccaaccaaaactggag
ccgctgaaactcagcaaaattgaagcggccatgagctttaccatcgccaaaggcatggtt
gcgcagacggcagggaaacattacccagccccgatcaccgccgtgaaaacgattgaagct
gccgcccgctttggtcgtgaagaagcgctgaacctggaaaaccaaagttttgtcccgctg
gcgcacaccaacgaggcgcgtgcgctggtcggtattttcctcaacgatcagtacgtcaaa
gcgaaagcgaaaaaactgacgaaggatattgagacaccgaagcaagccgcagttctgggc
gcaggcattatgggtggcggtatagcctaccagtctgcctggaaaggcgtgccggttatc
atgaaagatatcaacgataaatcgctgacgctgggcatgaccgaagccgccaagctgctg
aataagcaacttgagcgcggcaagatcgacggtctgaagatggcgggcgtgatttccacc
atccaaccaaccctcgactacaccggctttgagcgcgtggacgtggtggtggaagcggtt
gttgaaaatccaaaagtgaaaaaagcggtgcttgcagagaccgaagataaagtgcgcccg
gataccgtgctggcgtcaaacacgtccaccattccgattagcgaactggccagtgttctg
aagcgcccggaaaacttctgtggcatgcacttctttaacccggtgcaccggatgccgctg
gttgagatcatccgcggtgagaaaagctcggatgaaaccatcgctaaagtcgtcgcctgg
gccagtaagatgggcaaaacgccgattgtggtcaatgactgccctggcttctttgtaaac
cgcgtgctgttcccctacttcgccggtttcagccagttactgcgcgacggcgcggacttc
cgcaaagtcgataaggtgatggagaaacagttcggttggccaatgggcccggcgtattta
ctggacgtagtcggtattgataccgcacatcacgcgcaggcagtgatgtccgcaggcttc
ccgcagcgaatgcagaaagattatcgcgacgcgatcgatgccctgttcgatgccagccgc
tttggacagaaaaatggtctcgggttctggcgttataaagaagacagcaaaggcaagccg
aagaaagaagaggatgctgcggtcgatggcctgctggcagacgtcagccagccgaagcgc
gatttcagtgatgacgagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgcctggaagaaggcatcattgccagcccagcggaagccgatatggcactggtttac
ggtctcggcttccctccgttccacggcggtgcgttccgctggctggatacgctcggcagc
gccaaatacctcgatatggcgcagcaataccagcacctcggcccactgtatgaggtgcct
gaaggattgcgtaataaagcgcgtcataacgaaccgtactatccctcggttgagcctgcc
cgcccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system