KEGG   Citrobacter werkmanii: CO701_23645Help
Entry
CO701_23645       CDS       T05129                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00564  Glycerophospholipid metabolism
cwe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cwe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CO701_23645
Enzymes [BR:cwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CO701_23645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ATF51883
UniProt: A0A291D5X2
LinkDB All DBs
Position
complement(4791918..4793426)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPSS
TGLRFGADSVMKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKEFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDDSEINYLLQVYNAHF
KKQLGREDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKECILPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWIIGEATSLAELGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQARMTQWLAEYVEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaagcgcaggatttagcctgtgca
acctcctccgccagctccaaactcatccacggtggcctgcgctacctggaacactacgaa
ttccgtctggtcagcgaagcgctggctgaacgtgaagtcctgttgaagatggcaccgcat
atcgccttcccgatgcgctttcgtctgccccatcgcccgcacctgcgtccggcctggatg
atccgtattggtctgtttatgtacgatcatctgggcaaacgcaccagtttaccaagttcc
accggtttgcgttttggcgcagattctgtgatgaaacccgagattgtgcgcggtttcgaa
tattctgactgttgggtagacgatgcacgactggttttggcaaatgcccaaatggttgtg
cgtaaaggcggggaagtattaacccgtactcgcgccacctccgctcgtcgtgaaaacggt
ctgtggattgtcgaagcggaagatatcgataccggcaagaaacacacctggcaggctcgc
ggcctggttaacgccaccggtccgtgggtgaaagagttcttcgacgacggtatgcacctg
ccttcaccttacggtatccgcctgattaaaggcagccacattgtggtgccgcgcgtacac
acccagaaacaggcttacatcctgcaaaacgaagataaacgtattgtgtttgtcattccg
tggatggatgagttctcaattatcggcaccaccgacgtcgaatacaaaggcgatcctaaa
gcagtgaaaattgacgacagcgaaatcaattatctgctgcaggtctacaacgcacacttt
aagaaacagctgggccgcgaggatatcgtctggacctactcgggcgtacgcccgctgtgc
gatgacgagtccgactcgccgcaggctattacccgcgattatacgctggatatccacgac
gaaaacggcaaagcgccgctgctgtcagtcttcggcggcaagttaaccacctaccgtaag
ctggccgagcacgcgatggaaaaactgtcgtcgtactatcagggcatcggtccggcatgg
accaaagagtgcatcctgcctggcggtgacatcggcggcgatcgcgaagattacgcggca
aaactgcgccgtcgctatccgttcctgaccgaatcactggcgcgccactattcgcgcacc
tacggcagcaacaccgagtggatcatcggcgaagcgacctcgcttgctgagttaggcgaa
gacttcgggcacgagttctatgaggcagagctgaagtatctggtcgatcacgaatgggta
cgccgcgccgacgatgcgctgtggcgccgcacgaaagaaggcatgtggctgaacgctgag
cagcaggcacgcatgacccagtggctggcggagtatgttgaaaaacaccagctgtcgctg
gcgtcctga

DBGET integrated database retrieval system