KEGG   Conexibacter woesei: Cwoe_0911Help
Entry
Cwoe_0911         CDS       T01153                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cwo  Conexibacter woesei
Pathway
cwo00020  Citrate cycle (TCA cycle)
cwo00480  Glutathione metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
cwo01210  2-Oxocarboxylic acid metabolism
cwo01230  Biosynthesis of amino acids
Module
cwo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cwo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_0911
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cwoe_0911
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Cwoe_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ADB49344
UniProt: D3FBH5
LinkDB All DBs
Position
complement(953157..954371)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVKNPVVELDGDEMTRIIWQFIKDQLILPYVDVDLKYYDLGIESRDATDDQITVDA
ANAIKQYGVGVKCATITPDEGRVEEFGLKEMYRSPNGTIRNILGGVVFREPIVISNIPRL
VPGWTKPIVIGRHAFGDQYRATDTLIPGEGTLTLTYTPKNGGEPVELNVYDFKSSGIAMA
MYNVDDSIRDFARASMRYGLDRGFPVYLSTKNTIMKKYDGRFKDLFQEVFDAEFKADFDA
AGITYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
TVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLAARGRMDDTPEVTEFAQTLER
VCVETVESGKMTKDLALLVGPDQPFLTTQEFLAAIDENLQAAMK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtgaagaaccccgtcgtcgagctcgacggcgacgagatgacgcgg
atcatctggcagttcatcaaggaccagctgatcctcccctacgtcgacgtcgacctgaag
tactacgacctcggcatcgagagccgcgacgcgaccgacgaccagatcacggtcgacgcg
gccaacgcgatcaagcagtacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gggcgcgtcgaggagttcggcctgaaggagatgtaccgctcgccgaatggcacgatccgc
aacatcctcggcggcgtcgtcttccgcgagccgatcgtgatctccaacatcccgcgcctc
gtgccaggctggacgaagccgatcgtgatcggccgccacgccttcggcgaccagtaccgc
gcgaccgacacgctgatcccgggtgagggcacgctgacgctgacctacacgcccaagaac
ggcggcgagcccgtcgagctgaacgtctacgacttcaagagcagcggcatcgcgatggcg
atgtacaacgtcgacgactcgatccgcgacttcgcgcgcgcctcgatgcgctacggcctc
gatcgcggcttcccggtctacctgtcgaccaagaacacgatcatgaagaagtacgacggg
cgcttcaaggacctcttccaggaggtcttcgacgccgagttcaaggccgacttcgacgcc
gccggcatcacctacgagcaccgcctgatcgacgacatggtcgccgcggcgatgaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggcgacgtccagtcggacaccgtc
gcgcagggcttcggctccctgggcctgatgacctccgtgctgacgacgccggacggcaag
accgtcgaggccgaggccgcccacggcaccgtcacgcgccactaccggcagcaccagcag
ggcaagccgacgtcgaccaatccgatcgcgtcgatcttcgcctggacgcgcggcctcgcc
gcccgtggccgcatggacgacacgcccgaggtgaccgagttcgcgcagacgctcgagcgc
gtctgcgtcgagacggtcgagagcggcaagatgacgaaggacctggcgctgctcgtcggc
cccgaccagccgttcctcaccacccaggagttcctcgccgcgatcgacgagaacctccag
gcggcgatgaagtaa

DBGET integrated database retrieval system