KEGG   Conexibacter woesei: Cwoe_2806Help
Entry
Cwoe_2806         CDS       T01153                                 

Definition
(GenBank) peptidase M20
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
cwo  Conexibacter woesei
Pathway
cwo00220  Arginine biosynthesis
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01130  Biosynthesis of antibiotics
cwo01210  2-Oxocarboxylic acid metabolism
cwo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Cwoe_2806
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Cwoe_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADB51225
UniProt: D3FAR2
LinkDB All DBs
Position
complement(2993361..2994638)
Genome map
AA seq 425 aa AA seqDB search
MTAADRTTVADLTPRALAVLDAGAIERDLCRLVRVPSPTGDERAALELLGELCTERGIDA
TLHEHDVAALRLADGYPGEEAGRSELLGLTADVAGHGGARLCLAGHLDVVDPGAAEWTHG
PWSGAVVDGAVHGRGAVDMKGGVVAALHAIGAVRDAAGADGPPCDLTLLGLSSEEDGGLG
AFAQLARDDRFDGCVIPEPTDFRVIAAHGGALTFTGEVGGVSAHAAFRLAGVSAIDRYLP
IHGALAELEQRLNRDVSDPLMAQLELPYPLSVGRVQAGRWSSQVPDRLEFEGRVGVPVGS
GAAEVRKLVESTVQAAAGDGPPVRLRWTGGQFGAGATPVEHPLTQLVARSLGAETSPQAT
AAPIAGISYGADMRLFTERGIPCVLAGPGPSRLAHAVDEHVLVADVLRTARMLVRTIAGF
GAVAR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcagaccggaccaccgtcgccgacctgacgccgcgcgcgctcgccgtgctc
gacgcgggcgcgatcgagcgcgacctctgccggctcgtgcgtgtgccgtcgccgaccggc
gacgagcgcgcggcgctggagctgctcggcgagctgtgcaccgagcgcgggatcgacgcg
acgctgcacgagcacgacgtcgcggcgctgcggctcgccgacggctacccgggcgaggag
gccggccgcagcgagctgctcggcctgacggcggacgtcgccggccacggcggcgcgcgc
ctgtgcctcgccggccatctcgacgtcgtcgaccctggcgccgccgagtggacgcacggg
ccgtggagcggcgccgtcgtcgacggcgcggtgcacggccgcggcgccgtcgacatgaag
ggcggcgtcgtggcggcgctgcacgcgatcggcgcggtgcgcgacgcggcgggagcggac
gggccgccgtgcgacctgacgctgctcggcctctcctccgaggaggacggcggcctcggc
gcgttcgcgcagctggcgcgcgacgaccgcttcgacggctgcgtgatccccgagccgacc
gacttccgggtgatcgccgcccacggcggggcgctgacgttcacgggcgaggtcggcggc
gtctcggcgcacgccgcgttccggctcgccggcgtctcggcgatcgatcgctacctgccg
atccacggcgcgctcgccgagctggagcagcggctcaaccgcgacgtctccgacccgctg
atggcgcagctggagctgccctatccgctctcggtcggccgcgtccaggcaggaaggtgg
tcgagccaggtgcccgaccggctggagttcgagggccgcgtcggcgtgccggtcggcagc
ggcgctgcggaggtccggaagctggtcgagtcgaccgtgcaggcggcggccggcgacggc
ccgccggtgcggctgcgctggaccggcgggcagttcggcgccggcgcgacgccggtcgag
catccgctgacgcagctcgtcgcccgctcgctcggggccgagacgagcccgcaggccacc
gcggcgccgatcgccggcatcagctacggcgcggacatgcgcctcttcaccgagcgcggc
atcccgtgcgtgctggccggccccggcccgtcgcgcctggcgcacgccgtcgacgagcac
gtgctcgtcgccgacgtgctgcggaccgcgcggatgctcgtgcggacgatcgcgggcttc
ggcgcggtggcacgatga

DBGET integrated database retrieval system